KEGG   Burkholderia ambifaria MC40-6: BamMC406_3143Help
Entry
BamMC406_3143     CDS       T00684                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bac  Burkholderia ambifaria MC40-6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ACB65617
UniProt: B1YXR7
LinkDB All DBs
Position
2:complement(43351..44652)
Genome map
AA seq 433 aa AA seqDB search
MTSHSSSKPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLSNTQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMIESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATVYGWREAFYVSC
IPGFLIAFCIWRWVREVPPGGVRHAQAIGAGAPAASGAAINRWALLKERNILLCVLISCF
FLTWFVVIISFAPVFLVESRHLSPADMGIVMTCLGAAWVFWGFAVPAISDRIGRKPTMIA
FALVAAVCPVVMIHVGSVWALGALVFATYTGLGCFTLFMATIPAETVPPRAIASALGLIM
GAGELIGGFIAPTVAGFTADRYGLQFAMWTSAAGAILACVLSFGLVETAPAVLRKRALAG
ATTRLDTQNLGGR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccattcctcctccaaaccggcatggacgtatgagaacaggttgctgctgatc
ctgttcatgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgttcccg
ttcatgtcggccgagctgcatctgtcgaatacgcagctcggcatggtgtcgtccgcgctc
gcgctcacgtgggcgctgtcgggtgccgcgaccggcgcatggtccgatgcgcgcggcacg
cgcaagccgctgctgatcgccgcggtgctcggcttctccgtgtgctcggcgctgtcgggg
ctcgtcggcggcttcgcgagcctgatcgcgtttcgcgcgctgatgggcatcgccgaaggg
cccgtgctgccgctgtcgcaatcgctgatgatcgagagttcgacgccgagccgtcgcgga
ttgaacatgggtctgctgcagggctcggccgccggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcggcatcgcgaccgtctacggctggcgcgaggcgttctacgtctcgtgc
attccgggcttcctgatcgcgttctgcatctggcgctgggtgcgtgaagtgccgcccggc
ggcgtacggcatgcacaggccatcggcgccggcgcgccggccgcgagcggcgcggcgatc
aaccgctgggcgctgttgaaggaacgaaacatcctgctctgcgtgctgatcagctgcttc
ttcctcacgtggttcgtcgtgatcatctcgttcgcgccggtcttcctcgtggaaagccgc
catctgtcgccggccgacatgggcatcgtgatgacctgcctcggcgccgcgtgggtgttc
tggggctttgcggtgccggcgatctccgaccgcatcggccgcaagccgacgatgatcgcg
ttcgcgctggtcgcggccgtgtgcccggtcgtgatgatccatgtcggctcggtctgggcg
ctcggcgcactcgtattcgccacgtacacgggcctcggctgcttcacgctgttcatggcg
acgatcccggccgaaaccgtgccgccccgcgcgatcgccagcgcgctcggcctgatcatg
ggcgcgggcgagttgatcggcggcttcatcgcgccgaccgtcgcgggcttcacggccgac
aggtacggcctgcagttcgcgatgtggacgtcggctgccggcgcgattctcgcgtgcgtg
ctgtcgttcggcctcgtcgaaaccgcgcccgccgtgttgcgcaagcgcgcgctcgccggc
gccaccacccgtctcgatacccagaacctcggaggacgctga

DBGET integrated database retrieval system