KEGG   Burkholderia ambifaria MC40-6: BamMC406_3146Help
Entry
BamMC406_3146     CDS       T00684                                 

Definition
(GenBank) aldo/keto reductase
  KO
K05882  aryl-alcohol dehydrogenase (NADP+) [EC:1.1.1.91]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BamMC406_3146
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.91  aryl-alcohol dehydrogenase (NADP+)
     BamMC406_3146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: ACB65620
UniProt: B1YXS0
LinkDB All DBs
Position
2:complement(46561..47508)
Genome map
AA seq 315 aa AA seqDB search
MALRTLGTSDIQVSPLAFGGNVFGWTVDENASFALLDVLADTGINFIDTADVYSAWAPGN
SGGESETIIGKWLKRSGKRDQVVIATKVGLLEARAGLSKDNILKAADDSLRRLQTDYIDL
YFSHRDLADTAPLEETLAAYQTLIDAGKVRIIGASNYSGARLREAADISKRDGLPAYQVI
QPEYNLIDRAEYERDLEPVVRDLKLGVVNYYALASGFLSGKYRSEADLKKSVRGDRVAGY
LDARGLRILAALDDVSAKHGTQPAAIALAWQIARPTITAPIASATSLSQLALLGEAIRVK
LDDEDIRKIDEASAV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcactacgcaccctcggcacgtcggacatccaggtttccccgctcgccttcggcggc
aacgtcttcggctggactgtcgacgagaacgcatcgtttgcgctgctcgacgtgctcgcc
gacaccggcatcaacttcatcgacacggccgacgtctattcggcctgggcgcccggcaac
agcggcggcgaatccgaaacgatcatcggcaagtggctcaagcgttccggcaagcgcgac
caggtcgtgatcgcgaccaaggtcggcctgctcgaggcgcgcgcgggcctctcgaaggac
aacatcctgaaggccgccgacgattcgctgcgccgcctgcagaccgactacatcgacctg
tatttctcgcaccgcgatctcgccgacacggccccgctcgaggaaacgctcgccgcctac
cagacgctgatcgacgcgggcaaggtgcgcatcatcggcgcgtcgaactacagcggcgcg
cgcctgcgcgaggccgccgacatcagcaagcgcgacggcctgccggcttaccaggtgatc
cagccggaatacaacctgatcgatcgcgccgaatacgagcgcgacctcgaaccggtcgtg
cgcgacctgaaactcggcgtcgtcaactactacgcgctcgcgagcggcttcctgtcgggc
aagtaccgcagcgaggccgacctgaagaagagcgtgcgcggcgatcgcgtcgccggctat
ctcgatgcgcgcggcctgcgcattctcgcggcgctcgacgacgtgtcggcgaagcacggc
acgcaaccggccgcgatcgcgctcgcatggcagatcgcgcggccgacgatcaccgcgccg
atcgcgagcgccacgtcgctgtcgcagctcgcgctgctcggcgaagcgatccgcgtgaag
ctcgatgacgaagacatccgcaagatcgacgaggccagcgcggtgtga

DBGET integrated database retrieval system