KEGG   Burkholderia ambifaria MC40-6: BamMC406_3486
Entry
BamMC406_3486     CDS       T00684                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
Organism
bac  Burkholderia ambifaria MC40-6
SSDB
Motif
Pfam: Pyr_redox_2 FAD_binding_2 HI0933_like DAO NAD_binding_8 NAD_binding_9 Pyr_redox_3 GIDA FAD_oxidored Lycopene_cycl Amino_oxidase FAD_binding_3 Pyr_redox AlaDh_PNT_C
Other DBs
NCBI-ProteinID: ACB65953
UniProt: B1YZT4
LinkDB
Position
2:complement(413002..413916)
AA seq 304 aa
MQNHHEVIVIGGSFAGLSAAMQLARARRRVLVIDAGQPRNRFAEHAHGFFGQDGKPPARI
VADAAAQLAAYPTVQRIAGETRTAERDASGRFHVTLADGSRASADRLILATGIRDVLPAL
PGLAERWGVSVLHCPYCHGYEVSDRQLGVLATHPLSVHQAILIPDWGPTTWFTQRIVEPN
EEEAALLDARGVRIERSPVVEILGDAPRIDALRLADGQVVPIDALFIGARTEMASDLAQQ
LGCAFDEGPLGVAIRVDTWKQTSIPGVFAAGDASSLMTNATFASASGVAAGVGAHRSLIF
GLDA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgcagaaccatcatgaagtgatcgtgatcggcggcagctttgccgggctgtcggccgcg
atgcaactggcgcgcgcgcgacgccgcgtgctcgtgatcgatgccgggcagccgcgtaat
cgtttcgcggagcatgcgcacggctttttcgggcaggacggcaagccgccggcgcggatc
gtcgccgacgccgccgcgcaactcgccgcctatccgaccgtgcagcggatcgctggcgaa
acgcgcaccgccgagcgcgacgcgagcggccgctttcacgtgacgctcgcggacggcagc
cgcgccagcgccgaccggctgatcctcgcgaccggcatccgcgacgtattgcccgcgctg
ccggggctcgcggaacgctggggcgtcagcgtgctgcattgtccgtattgccatgggtac
gaggtgtcggatcggcaactcggcgtgctggccacgcatccgctttcggtgcatcaggcg
atcctgattccggactgggggccgacgacgtggttcacgcaacgcatagtcgaaccgaac
gaagaggaagccgcgttgctggacgcgcgtggcgtgcgcatcgagcggtcgccggtcgtc
gagatcctcggcgacgcaccgcgtatcgacgcgttacggctcgccgacgggcaggtcgtg
ccgatcgatgcgctgttcatcggcgcgcgtacggagatggcgagcgatctcgcgcaacag
ctcggctgtgcattcgacgaagggccgctcggcgtggcgatccgcgtcgatacgtggaag
cagacgagcattcccggcgtgttcgcggcgggcgatgcgtcgagcctgatgacgaatgcg
acgttcgcgtcggcatcgggcgtcgccgccggcgtgggcgcgcatcgttcgttgattttc
gggcttgacgcatga

DBGET integrated database retrieval system