KEGG   Burkholderia ambifaria MC40-6: BamMC406_3536
Entry
BamMC406_3536     CDS       T00684                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00303  sarcosine oxidase, subunit beta [EC:1.5.3.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00260  Glycine, serine and threonine metabolism
bac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_3536
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     BamMC406_3536
SSDB
Motif
Pfam: DAO NAD_binding_8 FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 Pyr_redox GIDA Thi4 3HCDH_N HI0933_like Pyr_redox_3 NAD_binding_9 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: ACB66003
UniProt: B1YZY4
LinkDB
Position
2:complement(466851..467999)
AA seq 382 aa
MSERRHYDVAIVGGGLVGASAALALARRGLRVALFERRDCGAQASGVNYGGVRCQGRPAE
QLPLALRARRIWDRLPELIGIDGEFVASGHLRLARSDADLDALDAYATVAGEHGLPLQVM
RGDTFRRRYPWLGRAALGGSLCATDGHANPRVVSPAFARAARAAGADVFEHAAVDDARHD
GMRFHVQATGRAYTATWLINSAGAWANTIAERFGEAVPMEPIYPNMWVTEPLPPFITHNL
GVYGGGVYARQVARGNCVIGGGRGRGDGEFGQPSVDTTRAVMRDACALLPALRDALLIRT
WSGVEGCTPDHNPIIGASRTTPNLLHAFGFSGGGFLLAPGVGEVLAELVTTGETATPLEA
FSIGRFAPHAPIAPFRQEETHK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagtgaacgccgtcactacgacgtcgcgatcgtcggcggcggcctcgtcggcgcgtcg
gccgcgctggcgctcgcgcggcgcgggctgcgcgtcgcgctgttcgagcgccgcgactgc
ggcgcgcaggcgagcggcgtgaactacggcggcgtgcgctgccagggccgccccgccgag
cagttgccgctcgcgctgcgcgcacggcgcatctgggaccgcctgcccgagttgatcggc
atcgacggcgaattcgtcgcgtcgggccacttgcggctcgcgcgcagcgacgccgacctc
gatgccctcgatgcgtatgcaacggtcgccggcgagcacggcctgccgctgcaggtaatg
cgcggcgacacgttccgccgccgctacccgtggctcggccgcgcggcgctcggcggctcg
ctgtgcgcaaccgatggccacgcgaacccgcgtgtcgtgtcgcccgccttcgcgcgtgcg
gcccgcgcggcgggcgccgacgtgttcgagcacgcagccgtcgacgacgcccggcacgac
ggcatgcgctttcacgttcaggcgaccggccgcgcgtacacggcgacgtggctgatcaat
tcggccggcgcatgggcgaacaccatcgccgaacgcttcggcgaagccgtgccgatggag
ccgatctatccgaacatgtgggtgaccgagccgctgccgccgttcatcacgcacaacctc
ggcgtgtacggcggcggcgtgtacgcgcggcaggtcgcgcgcggcaactgcgtgatcggc
ggcgggcgcggccgaggcgacggcgaattcggccagccttcggtcgacacgacgcgcgcg
gtgatgcgcgacgcgtgcgcgctgttgcccgcgctgcgcgatgcgctgctgatccgcacg
tggagcggcgtcgaaggctgcacgcccgaccacaacccgatcatcggcgcgagccgcacg
acgccgaacctgttgcatgcgttcggcttttcgggcggcggcttcctgctcgcgccgggc
gtcggcgaagtactcgccgagctcgtcacgaccggcgaaaccgccacgccactcgaagca
ttctcgatcggccgcttcgcgccgcacgcgccgatcgcccctttccgtcaagaggagacc
cacaagtga

DBGET integrated database retrieval system