KEGG   Burkholderia ambifaria MC40-6: BamMC406_3670
Entry
BamMC406_3670     CDS       T00684                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K18249  anthranilate 1,2-dioxygenase ferredoxin reductase component [EC:1.18.1.-]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00627  Aminobenzoate degradation
bac01100  Metabolic pathways
bac01120  Microbial metabolism in diverse environments
Module
bac_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BamMC406_3670
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.-  
     BamMC406_3670
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox NAD_binding_8 TrkA_N NAD_binding_7 3HCDH_N HI0933_like 2-Hacid_dh_C XdhC_C DAO AlaDh_PNT_C GIDA UDPG_MGDP_dh_N Amino_oxidase Lycopene_cycl FAD_binding_2 UPF0146
Other DBs
NCBI-ProteinID: ACB66137
UniProt: B1Z0L6
LinkDB
Position
2:625220..626440
AA seq 406 aa
MSTDPFVIVGAGHAARRTAEALRARNADARIVMIGAERELPYDRPALSKDALLSDGGEQR
AFIRDAAWYDAQRIELRLGTRVDEIERDARRVRLDDGATLPYARLVLATGSRVRAFGGPV
DEGVVPHYVRTVADARALRAQLAPGRRVAVLGGGFIGLEVAAAARQRGCDVTVIDPAPRL
LQRALPEVVGAYARQLHDAHGVNFQMATLPRAIRRGAGGGAIVETDRGDVPADIVVVGIG
VVPNVELAQAAGLEVDNGIRVDAGCRTADQAIFAAGEVTMHFNPLLGRHVRIESWQVAEN
QPAIAAANLLGADETYAELPWLWSDQYDCNLQMLGLFGSERTTVVRGDPASGPFTVFGLG
DDGRIVAVAAANLGRDIGASRRLIAAGAVPDPVKLADPAVNLKTFL
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtcgactgacccgttcgtgatcgtcggcgccggccatgcggcgcggcgcacggccgag
gcgctgcgcgcgcgcaacgccgatgcgcgcatcgtgatgatcggcgcggagcgcgagctg
ccgtacgaccggcccgcgctgtcgaaggacgcgctgctgagcgacggcggcgagcagcgc
gcgttcatccgcgatgccgcgtggtacgacgcgcagcgcatcgagctgcggctcggcacg
cgtgtcgatgagatcgaacgcgatgcacggcgtgtgcggctcgacgacggtgcgacgttg
ccgtacgcacggctcgtgctcgcgacgggttcgcgggtgcgtgcgttcggcggtccggtc
gacgaaggcgtcgttcctcattacgtgcgcaccgtcgccgacgcgcgcgcgttgcgggcg
cagcttgcgcccggacgccgcgtggcggtgctcggcggcggcttcatcggcctggaagtg
gcggccgcggcgcgccagcgcggctgcgacgtgacggtgatcgacccggcgccgcgcttg
ctgcagcgtgcgttgccggaagtcgtcggcgcgtatgcgcggcaactgcatgacgcgcac
ggcgtgaactttcagatggcgacgctgccccgtgcgattcgccgcggagcgggtggcggt
gcgatcgtcgagaccgatcgcggcgacgtgccggccgatatcgtcgtggtcgggatcggc
gtggtacccaacgtcgagcttgcgcaggcggccggcctcgaggtcgacaacgggatccgt
gtcgatgcgggctgccgcacggccgatcaggcgatctttgcggcgggcgaggtgacgatg
cacttcaatccattgctcgggcgtcacgtgcggatcgagtcgtggcaagtcgcggaaaac
cagccggcaatcgcggccgcgaacctgcttggcgcggacgaaacctatgccgagctgccg
tggctgtggtccgatcagtacgactgcaacctgcagatgctcggcttgttcggcagcgaa
cgcacgacggttgtgcgcggcgatccggcgagcgggccgttcacggtgttcggactgggc
gacgatggcaggatcgtcgcggtggccgcggcgaacctcgggcgcgacatcggcgcgtcg
cgccggctgatcgcggccggggctgtgcccgacccggtgaagcttgccgatccggcggtg
aacctgaagacgttcctctga

DBGET integrated database retrieval system