KEGG   Burkholderia ambifaria MC40-6: BamMC406_3983Help
Entry
BamMC406_3983     CDS       T00684                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BamMC406_3983
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BamMC406_3983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 DAO Glutaredoxin Thi4 NAD_binding_8 K_oxygenase FAD_oxidored AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: ACB66448
UniProt: B1Z2L2
LinkDB All DBs
Position
2:complement(985391..986989)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIGSLTSRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHIAIDGALFQNEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGASARAAKSLEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIILATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGEAKRVDLEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPATADAPQAEEAIAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaatcaactgaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcgtcgctcgacgacagcgcgaagtcgcaggaactgcttgcgctgctc
aacgagattggttcgctgacgtcgcgcgtgaccgtgaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgaacccggcaagcctgcgggcatccgcttcgccggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcaaacgggcggccat
ccggtcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactacgcg
ttcgaaacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacatcgcgatcgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggccgtgccgacgatgttcctgaacggcgaatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgacacgggcgctagt
gcccgcgccgcgaagtcgctcgagaagaagccggtgttcgacacgctgatcgtcggcggc
ggcccggccggtgcggccgccgcgatctactcggcgcgcaagggcatcgcgacgggcgtg
gtggccgagcgcttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaggggccgaagttcgccaccgcgctcgagcagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgacgcgttgattccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcatcctggcaaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgtgtcgcggtggtcggtggcggc
aactcgggtgtcgaggccgcgatcgacctggccggcatcgtgaaggaagtcacgctgctc
gaatacggcgcgcaactgcgcgcggacgaggtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacccaggcgcagacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatttgcgttcgggtgaagcgaagcgcgtcgatctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggcacgatcgagctg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcgtcgctcggcgcgttcgatcacctgatccggcaggacgcgacgccggccacg
gccgacgcgccgcaggccgaagaagcgatcgccgcgtaa

DBGET integrated database retrieval system