KEGG   Burkholderia ambifaria MC40-6: BamMC406_4016Help
Entry
BamMC406_4016     CDS       T00684                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00440  Phosphonate and phosphinate metabolism
bac01100  Metabolic pathways
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BamMC406_4016
Enzymes [BR:bac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BamMC406_4016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ACB66481
UniProt: B1Z2P5
LinkDB All DBs
Position
2:complement(1032565..1034253)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFSESRSARLRRMLVSNELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQSDTDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTEPTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNV
RGAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcgcgaacccaacttctccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcaacgaactcgaattcctgatggaagcgcacaacggcctgtccgcacggatcgtc
cgcgaagccggcttcaaggggatctgggcatcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaagat
aaacaattcccgaagaccaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgacaccgacttctcg
atcgtcgcgcgcgtcgaggcactgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcatacgcggaagccggtgcggacgcgatcctgatccacagcaagctgtcgcgc
cccgacgaaattctccagttcgcacgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcgtcggccatgcaggccgtcgcgcgcgag
attcatgaaaacgagacgctgatcaacgtcgaggaccgcgtcgcgtccgtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcagccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaaggggctcgaggcc
gtcaccgaggataagcccaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgtcacgcgcagacg
ggcgaactcgcgtcgctcgcgtgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgactcgtcgctgaccgagccgaccaaccagagcgtgcgcgatttc
gcgctctgctcggccgccgacgaccgcggcctgttcggtcagaaaacctacctgcaacgc
gtatcgagcgacgtcgccgcaggcacgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcaggcgtggaccgcctgaaggcgatgctcgcgacgctgcaggcgcgtcctgat
ttcgacacgctcgatatcccgtcgctgctcaacgagctgatcgccgccggcgagaagatc
gaagtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgctgtccgagccgggcgccggcaacgggggc
gcgcaatga

DBGET integrated database retrieval system