KEGG   Burkholderia ambifaria MC40-6: BamMC406_4034
Entry
BamMC406_4034     CDS       T00684                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00330  Arginine and proline metabolism
bac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BamMC406_4034
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     BamMC406_4034
SSDB
Motif
Pfam: Pyr_redox_2 DAO FAD_oxidored NAD_binding_8 FAD_binding_2 Thi4 HI0933_like Fer2_BFD GIDA NAD_binding_9 FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl Pyr_redox NAD_binding_7 3HCDH_N TrkA_N Amino_oxidase XdhC_C 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ACB66499
UniProt: B1Z2R3
LinkDB
Position
2:1054134..1055414
AA seq 426 aa
MKQERLSVDVAIVGAGPAGLSAARAAARSGATVAIVDDNPRAGGQIWRQAAAATPVAAAA
ERLAVLRQANVTHLAATRIVAETQPGTLLLEDDERGFLLEFRTLIVCCGARELLLPFPGW
TLPGVTGAGGLQALIKYGLDVRGQRTVIAGSGPLLLASAATARQAGAQVSHVLEQAAWGD
VAGFGAGLWRWPSKLAQAAKLVTAAYRPNAYVVEAFGDKRLERVRIRQGEREFDVDCDRL
ACGFGLVPNTVLPSHLGCRIENGAVVVDAHQRTSRDGYFAAGECTGVGGSELAMVEGEIA
GCAATGQVAPLAALVARRAHWQAFADAVRERFAIREPIRRLARRDTLLCRCEDVRFDAVA
DAVAPAPGWTAAKLQTRCGMGACQGRVCGAAAQALFGWTPPVPRTPLVPARVGTLMLDDT
ASCDGA
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgaaacaggaacgactgagcgtcgacgtcgcgatcgtcggcgcggggcctgccgggttg
tcggccgcgcgggccgccgcgcgaagcggcgcaacggtcgcgatcgtcgacgacaacccg
cgcgcgggcggacagatctggcgccaggccgccgccgcgacaccggtggcggccgctgcg
gaacgccttgccgtgctgcggcaggcgaacgtcacgcatctcgcggccacgcgcatcgtc
gccgaaacgcagccgggcacgctgctgctcgaggacgacgaacgcggctttctgctcgaa
ttccgcacgctgatcgtgtgctgcggcgcgcgtgagttgctgctgccgttcccgggctgg
acgctgccgggtgtcaccggcgcgggcggcctgcaggcgctgatcaagtacggtctcgac
gtgcgcgggcagcgcacggtgatcgctggcagcggcccgctgctgctcgcgagcgcggcg
acggcccgacaggcaggcgcgcaggtgtcgcacgtgctcgaacaggcggcatggggcgac
gtggccggtttcggcgcagggctgtggcgctggccgtcgaaactcgcgcaggccgcgaag
ctcgtcacggccgcctaccggcccaatgcctacgtcgtcgaagcgttcggcgacaagcgg
ctggaacgcgtgcggatccggcagggcgagcgcgagttcgacgtcgactgcgatcggctc
gcgtgcggcttcggcctcgtgccgaacaccgtgctgccgagccatctcggttgccggatc
gagaacggcgcggtggtggtcgacgcgcaccagcgcacgagccgcgacgggtatttcgcc
gcaggcgaatgcacgggtgtcggcggcagcgaactggcgatggtcgaaggcgagatcgcg
ggctgcgcggccaccgggcaggtggcgccgctggccgcgctggtggcgcggcgcgcgcac
tggcaggcgttcgcggatgcggtgcgcgagcgcttcgcgatccgcgagccgatccgccgg
ctcgcgcggcgcgatacgttgctgtgccgttgcgaggacgtgcgcttcgacgcggtggca
gacgcggtcgcgccggcgcccggctggacggccgcgaagttgcagacgcgctgcgggatg
ggcgcttgccagggccgcgtgtgcggcgcggccgcgcaggcgctgttcggctggacgccg
ccggtgccgcgcacgccgctcgtgcccgcacgggtcggtacgctgatgctggacgacacg
gcgtcctgcgacggtgcctga

DBGET integrated database retrieval system