KEGG   Burkholderia ambifaria MC40-6: BamMC406_4204
Entry
BamMC406_4204     CDS       T00684                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00280  Valine, leucine and isoleucine degradation
bac00410  beta-Alanine metabolism
bac00562  Inositol phosphate metabolism
bac00640  Propanoate metabolism
bac01100  Metabolic pathways
bac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BamMC406_4204
   00562 Inositol phosphate metabolism
    BamMC406_4204
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BamMC406_4204
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BamMC406_4204
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     BamMC406_4204
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     BamMC406_4204
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ACB66668
UniProt: B1Z388
LinkDB
Position
2:1257634..1259151
AA seq 505 aa
MKHDSNVTSTVGHLIDGKRVDGGSRVQPVFDPATGESHKSVALADKLTVEAAIASAQAAF
PAWRNTPPLKRARVMSRFKTLLEEHADELCALITAEHGKVLADAMGELQRGIENVEYATY
VPELLKGEHSKNVGPAIDSWSEFQALGVAAGITPFNFPVMVPLWMWPMAVACGNTFVLKP
SERTPSSTLRMAELALEAGLPPGVLNVVNGDKEAVDTILTDARVKAVSFVGSTPIAEYIY
STGCAHGKRVQALGGAKNFAVVMPDADIGNAVNALMGAAYGSCGERCMAIPLVVAIGDET
GDKVVQGLKAEIEKMKVGPGNGAGIDMGPLVTKQHFDKVTGFVAAGVEAGATLVVDGRGV
KVDGHDGGYYLGPCLFDHVKPGMPIYQHEIFGPVLGVIRLKSLDEAMALIDAHEYGNGTC
LFTRDGEAARYFGDNIQIGMVGINVPLPVPVAYHSFGGWKRSLFGDLHAYGPDAVRFYTK
RKTITQRWPSAGVREGTVFSFPSNR
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaacacgacagcaatgtgacctccaccgtcggccacctgatcgacggcaagcgcgtc
gacggcggcagccgcgtgcagccggtgttcgacccggcgaccggcgaatcgcacaagagc
gtcgcgctcgccgacaagctgaccgtcgaagccgcgatcgcgtccgcgcaggccgcgttc
cccgcgtggcgcaatacgccgccgctgaagcgcgcccgcgtgatgagccgcttcaagacg
ctgctcgaggagcacgcggacgaactgtgcgcgctgatcaccgccgagcacggcaaggtg
ctcgccgacgcgatgggcgaactgcagcgcgggatcgagaacgtcgaatacgcgacctac
gtgcccgagctgctgaagggcgagcacagcaagaacgtcggccccgcgatcgattcgtgg
agcgagttccaggcgctcggcgtcgccgccggcatcacgccgttcaacttcccggtgatg
gtgccgctgtggatgtggccgatggccgtcgcgtgcggcaacacgttcgtgctgaagccg
tccgagcgcacgccgtcgtcgacgctgcgcatggccgagctcgcgctcgaggccggcctg
ccgccgggcgtgctgaacgtcgtgaacggcgacaaggaagcggtcgacacgatcctgacc
gacgcgcgcgtgaaggcggtgagcttcgtcggctcgacgccgatcgccgaatacatctat
tcgaccggctgcgcgcacggcaagcgcgtgcaggcgctcggcggcgcgaagaacttcgcg
gtggtgatgcccgacgccgacatcggcaacgcggtgaatgcgctgatgggcgccgcttat
ggttcgtgcggcgagcgctgcatggcgatcccgctggtcgtcgcgatcggcgatgaaacg
ggcgacaaggtggtccaagggctgaaggccgagatcgagaagatgaaggtcggcccgggc
aacggtgccggcatcgacatggggccgctcgtcacgaagcagcatttcgacaaggtaacg
ggcttcgtcgcagcaggcgtggaagcgggcgcgacgctcgtcgtcgacggccgcggcgtg
aaggtcgacggccacgatggcggctactacctcggcccgtgcctgttcgatcacgtgaag
cccggcatgccgatctaccagcacgagatcttcgggccggtgctcggcgtgatccgcctg
aagtcgctcgacgaggcgatggcgctgatcgacgcgcacgaatacggcaacggcacgtgc
ctgttcacgcgcgacggggaagccgcgcgctacttcggcgacaacatccagatcggcatg
gtcggcatcaacgtgccgctgccggtgccggtcgcgtaccactcgttcggcggctggaag
cgctcgctgttcggcgacctgcacgcgtacggcccggatgcggtgcggttctacacgaag
cgcaagacgatcacgcagcgctggccgtcggccggcgtgcgcgaggggacggtgttcagc
ttcccgtcgaaccgctga

DBGET integrated database retrieval system