KEGG   Burkholderia ambifaria MC40-6: BamMC406_5067
Entry
BamMC406_5067     CDS       T00684                                 

Definition
(GenBank) sarcosine oxidase, alpha subunit family
  KO
K00302  sarcosine oxidase, subunit alpha [EC:1.5.3.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00260  Glycine, serine and threonine metabolism
bac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_5067
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     BamMC406_5067
SSDB
Motif
Pfam: GCV_T SO_alpha_A3 Fer2_4 GCV_T_C Pyr_redox_2 FAD_oxidored Pyr_redox_3 NAD_binding_8 FAD_binding_2 GIDA HI0933_like FAD_binding_3 NAD_binding_7 Pyr_redox DAO Thi4 AlaDh_PNT_C XdhC_C Lycopene_cycl
Other DBs
NCBI-ProteinID: ACB67513
UniProt: B1Z064
LinkDB
Position
2:complement(2234153..2237164)
AA seq 1003 aa
MSQKDRLGTGGRINRAIPLTFTFNGRTYQGFQGDTLASALLANGVHFVARSFKYHRPRGI
VTADVAEPNAVVQLESGPYTVPNARATEIELYQGLVATSVNAEPSLENDKYAINQKFSRF
MPAGFYYKTFMWPRNMWPKYEEKIREAAGLGKAPEMLDADRYDKCYAHCDVLVVGGGPSG
LAAAHAAATAGARVILVDDQRELGGSLLSCRAEIDGKPAQQWVEKIEAELRKLPDVTILS
RSTAFGYQDHNLVTITQRLTDHQPVSMRKGTRELLWKVRAKRVILATGAHERPIVFGNND
LPGVMLAGAVSTYVHRYGVMPGRNVVVFTNNDRAYQTALDLKACGAKVTVVDSRASSNGA
LPAAAKRQGVTVMSGAVVTAASGKWRVSSVDVASYTNGQTGSKLQSLPCDLVAMSGGFSP
VLHLFAQSGGKACWNDEKACFLPGKPVQAEASVGAAAGEFGLARALRLALDAGVEAAKAA
GFAAAQRVAAPQVAETVEGALQPLWLVGSREDAARGPKQFVDFQNDVAAADILLAAREGF
ESVEHVKRYTAMGFGTDQGKLGNINGMAILAQALGKTIPETGTTTFRPNYTPVSFGTFAG
RETGDFLDPIRKTAVHEWHVEHGALFEDVGNWKRPWYFPKNGEDLHAAVKRECLAVRNGV
GILDASTLGKIDIQGPDAVKLLNWMYTNPWNKLEIGKCRYGLMLDENGMVFDDGVTVRLA
DQHFMMTTTTGGAARVLTWLERWLQTEWPDMKVRLASVTDHWATFAVVGPKSRKVVQKVC
QDIDFGNEAFPFMSYRNGTVAGAKARVMRISFSGELAYEVNVPANAGRAVWEALMAAGAE
FDITPYGTETMHVLRAEKGYIIVGQDTDGSVTPYDLGMGGLVAKSKDFLGKRSLSRSDTS
KEGRKQFVGLLTEDEQFVLPEGAQIIAKDTQVSTVDPTPMIGHVTSSYYSPILKRSIALA
VVKGGLNKMGESVVIPLANGRRITAKISSPVFYDTEGVRQHVE
NT seq 3012 nt   +upstreamnt  +downstreamnt
atgagccagaaagaccgcctcggcaccgggggccgcatcaatcgcgcgattccgctgacg
ttcacgtttaacggccgcacgtatcaaggcttccagggcgacacgctcgcgtccgcgctg
ctcgcgaacggcgtgcacttcgtcgcgcgcagcttcaagtatcaccgtccgcgcgggatc
gtgacggcggacgtcgcggaaccgaatgccgtcgtgcagctcgagtccggcccgtacacg
gtgccgaacgcgcgcgcgaccgagatcgagctgtaccagggcctcgtcgcgacgagcgtg
aacgccgagccgtcgctcgagaacgacaagtacgcgatcaaccagaagttctcgcgcttc
atgccggccgggttctactacaagaccttcatgtggccgcgcaacatgtggccgaagtac
gaagagaagatccgcgaggccgccggcctcggcaaggcgcccgaaatgctcgacgccgat
cgctacgacaagtgctacgcgcactgcgacgtgctcgtggtcggcggtggcccgtcgggc
ctcgccgccgcgcatgcggccgcgacggccggcgcgcgcgtgatcctcgtcgacgaccag
cgcgagctcggcggcagcctgctgtcgtgccgcgcggaaatcgacgggaagccggcgcag
caatgggtcgagaagatcgaggccgagctgcgcaagctgcccgacgtgacgatcctgtcg
cgcagcaccgcgtttggttaccaggaccacaacctcgtgacgatcacgcagcgcctgacc
gatcaccagccggtgtcgatgcgcaagggtacgcgcgagctgctgtggaaggtccgcgcg
aagcgcgtgatcctcgcgaccggcgcgcacgagcgtccgatcgtgttcggcaacaacgac
ctgccgggcgtgatgctcgccggcgcggtgtccacctacgtgcatcgctacggcgtgatg
ccgggccgcaacgtggtcgtgttcacgaacaacgatcgtgcgtaccagaccgcgctcgac
ctgaaggcgtgcggtgcgaaggtgacggtcgtcgattcgcgtgcgtcgtcgaacggcgcg
ctgcctgccgccgcgaagcggcagggcgtgacggtgatgagcggtgccgtggtgacggcc
gcttcgggcaagtggcgcgtatcgtcggtcgacgtcgcgtcctacacgaacggccagacc
ggcagcaagttgcagtcgctgccgtgcgacctcgtcgcgatgtcgggcggcttcagcccg
gtgctgcacctgttcgcgcagtccggcggcaaggcgtgctggaacgacgagaaggcgtgc
ttcctgccgggcaagcccgtgcaggccgaggcgagcgtcggtgcggcggcgggcgagttc
ggtctcgcacgtgcgctgcggctcgcactcgacgcgggcgtcgaagcggcgaaggccgcc
ggcttcgcggctgcgcagcgcgtggccgcgccgcaggtcgccgaaaccgtcgaaggcgcg
ctgcagccgttgtggctcgtcggcagccgcgaggacgccgcacgcgggccgaagcagttc
gtcgacttccagaacgacgtggcggccgccgacatcctgctggccgcacgcgaaggcttc
gagtcggtcgagcacgtgaagcgctacaccgcgatgggcttcggcaccgaccagggcaag
ctcggcaacatcaacgggatggcgatcctcgcgcaggcgcttggcaagacgattcccgaa
acgggcacgacgacgttccgcccgaactacacgcccgtgtcgttcggtacgttcgcgggc
cgcgagaccggcgatttcctcgacccgatccgcaagacggccgtgcatgaatggcacgtc
gagcacggcgcgctgttcgaggacgtcggcaactggaagcggccgtggtatttcccgaag
aacggcgaggatctgcatgcggccgtgaagcgcgaatgcctcgcagtgcgcaacggtgtc
ggcatcctcgacgcgtcgacgctcggcaagatcgacatccagggtccggacgcggtgaag
ctgctgaactggatgtacacgaacccgtggaacaagctcgagatcggcaagtgccgctat
gggctgatgctcgacgaaaacgggatggtgttcgacgacggcgtgacggtgcgcctcgcc
gaccagcatttcatgatgacgacgaccaccggtggcgcggcgcgcgtgctcacgtggctc
gagcgctggctgcagaccgaatggcccgacatgaaggtgcggctcgcgtccgtcaccgat
cactgggcgacgttcgcggtggtcggcccgaagagccgcaaggtcgtgcagaaggtgtgc
caggacatcgacttcggcaacgaggcgttcccgttcatgagctaccggaacggcaccgtc
gcgggcgcgaaggcgcgcgtgatgcggatcagcttctccggcgagctcgcgtatgaagtg
aacgtgccggccaatgcgggccgcgcggtgtgggaagcgctgatggcggccggcgccgag
ttcgacatcacgccgtacggcaccgagacgatgcacgtgctgcgcgcggagaagggctac
atcatcgtcggccaggacaccgacggctcggtcacgccgtacgacctcgggatgggcggg
ctcgtcgcgaagtcgaaggacttcctcggcaagcgctcgctgtcgcgctcggatacgtcg
aaggaaggccgcaagcagttcgtcggcctgctgacggaagacgaacagttcgtgctgccg
gaaggcgcgcagatcatcgcgaaggacacgcaggtgtcgacggtcgatccgacgccgatg
atcggccacgtgacgtcgagttattacagcccgatcctgaagcgctcgattgcgctggcg
gtggtgaagggcggcctgaacaagatgggcgagagcgtcgtgattccgctggccaacggc
cgccgcatcaccgcgaagatctcgagcccggttttctacgataccgaaggggtgcgccag
catgtggaatga

DBGET integrated database retrieval system