KEGG   Burkholderia ambifaria MC40-6: BamMC406_5532
Entry
BamMC406_5532     CDS       T00684                                 

Definition
(GenBank) Electron-transferring-flavoprotein dehydrogenase
  KO
K00311  electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BamMC406_5532
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.1  electron-transferring-flavoprotein dehydrogenase
     BamMC406_5532
SSDB
Motif
Pfam: ETF_QO DAO FAD_binding_2 NAD_binding_8 Thi4 Pyr_redox_2 FAD_binding_3 HI0933_like Lycopene_cycl Pyr_redox_3 NAD_binding_9 FAD_oxidored Trp_halogenase Fer4_7 GIDA K_oxygenase
Other DBs
NCBI-ProteinID: ACB67975
UniProt: B1Z5C9
LinkDB
Position
3:complement(25597..27270)
AA seq 557 aa
MTTQDLLAQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGA
HILSGAVMDPRAINELFPDWKERGAPLDVAVTEDRFLFLSETGAVTTPNWALPANFQNHG
NYVISLGNVTRWLGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTEN
FQLGMELHAKYTLFAEGCRGHLGRQLISKFKLDANADPQAYGIGIKELWEIDPAKHKPGL
VIHTAGWPLKSDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAF
LEGGKRVSYGARAITAGGLLSLPKTVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAAD
AAFDAVQAGRQSDELNAYPDAFKQSWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMG
GNVPWTLHHKHADHEMLKPASQCTPIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTL
KDANVPVNVNLRTYAGPEARFCPAAVYEFVKNDDGGDRLVINAQNCVHCKTCDIKDPTQN
IVWVTPEGGGGPNYPNM
NT seq 1674 nt   +upstreamnt  +downstreamnt
ttgaccacacaggacttgctcgcgcagtacggcccgcgcgaatcgatggaatacgacgtc
gtgatcgtcggcggcggccccgccgggctgtcggcggcgatccggctcaagcagctggcc
gccgagaaaggcaccgagatcggcgtgtgcgtgctcgagaagggttccgagatcggcgcg
cacatcctgtcgggcgcggtgatggatccgcgcgcgatcaacgaactattccccgactgg
aaggaacgcggcgcgccgctcgacgtcgcggtgacggaagaccgcttcctgtttctgtcc
gagacgggcgcggtcacgacgcccaactgggcgctgcccgccaacttccagaaccacggc
aactacgtgatctcgctgggcaacgtcacgcgctggctcggggcacaggcggaagcgctg
ggcgtcgagattttcccgggcttccccgctgccgagattctctacaacgacgacggctcg
gtgaagggtgtcgccaccggcaacatgggcgtaggcaaggacggcgagccgaccgagaac
ttccagctcggcatggaactgcacgcgaaatacacgctgttcgccgaaggctgccgcggc
cacctcggccgccagctgatctcgaagttcaagctcgacgcgaacgccgatccgcaggcg
tacgggatcggcatcaaggagctgtgggaaatcgatccggccaaacacaagccgggcctc
gtgatccacacggccggctggccgctgaagtccgatacgtacggcggctcgttcctgtat
cacatggacaacaaccaggtcgtggtcggcttcgtggtgggcctgggctacacgaacccg
tacctgtcgccgttcgaggaattccagcgctacaagacacatccgtcgatccgcgcgttc
ctcgaaggcggcaagcgcgtgtcgtacggcgcgcgcgcgatcacggcgggcgggctgctg
tcgctgccgaagacggtgttcccgggcggcgcgctgatcggcgacgatgcgggcttcctg
aacgcatcgcgaatcaagggcagccacgcggcgatcaagaccggcatgctggcggcggac
gccgcgttcgacgcggtgcaggccggccgtcagagcgacgagctcaacgcgtatccggac
gccttcaagcaatcgtggctgtacacggagctgtaccgcgcgcgcaacttcaagcagtgg
atggccaaggggctgtatctcggcacgctgatggtcgggctcgagcagaaggtgatgggc
ggcaacgtgccgtggacgctgcatcacaagcatgcggaccacgagatgctgaagccggca
tcgcaatgcacgccgatcgagtatccgaagccggatggcaagctgacgttcgatcggctg
tcgtcggtgttcatctcgaacacgaaccacgaggaaaaccagccggcgcatctgacgttg
aaggatgcgaacgtgccggtgaacgtgaacctgcgcacgtacgcggggccggaagcccgc
ttctgcccggcggcggtgtacgagttcgtgaagaacgacgacggcggcgatcgcttggtg
atcaacgcgcagaactgcgtgcactgcaagacctgcgacatcaaggacccgacgcagaac
atcgtgtgggtcacgccggaaggtggcggcgggccgaattacccgaacatgtaa

DBGET integrated database retrieval system