KEGG   Burkholderia ambifaria MC40-6: BamMC406_5864Help
Entry
BamMC406_5864     CDS       T00684                                 

Definition
(GenBank) beta-lactamase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac01501  beta-Lactam resistance
bac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bac00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BamMC406_5864
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BamMC406_5864
Enzymes [BR:bac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BamMC406_5864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACB68302
UniProt: B1Z3I9
LinkDB All DBs
Position
3:394683..395852
Genome map
AA seq 389 aa AA seqDB search
MRFNAIRIAATLFVAACAAVTAGRAAAATPDEIHDTVTRNVAPLMKQFAIPGMAIGIVAD
GKPYVFDYGVMSTQTGKPVTGDTLFEIGSVSKTLTGTLASDAQEGGELSLSDPVAKYLPA
LQGKPFGGVTLLELGTYTPGGMPLQVPDSIRDDAALMRYLDAWRPAYVPGTRRTYSNVAL
GMLGQLTAKAMNGDFAALMEQRLFPALGMTHTYINVPAARRGDYAQGYTQDGKPIRMTGG
MLWQPAYGVKTTATDLLRFVQANMGLVDTAPRMQRALERTHTGYFRAGPFTQDLIWEQYP
YPVALPTLLEGNGPAMLHGATPATELKPPLAPRPDTWINKTGSTNGFSTYVAFVPAKRMA
IVMLANRSFPIENRVKAAYRIVESLNGKP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcaacgcgatacgcatcgccgcgaccctgttcgtcgccgcgtgcgccgccgtc
acggccggccgcgcggcggccgcaacgcccgacgagattcacgacaccgtgacccgcaac
gtcgcgccgctgatgaagcagttcgccattcccggcatggcgatcggcatcgtcgccgac
ggcaagccctacgtgttcgactacggcgtgatgtcgacgcagaccggcaagccggtaacc
ggcgacacgttgttcgagatcggctccgtcagcaagacgctgaccgggacgctcgcgtcc
gatgcgcaggagggcggcgagctgtcgctgtcggatcctgtggccaagtacctgcccgcg
ctgcagggcaagccgttcggcggcgtgacgctgctcgagctcggcacgtacacgccgggc
gggatgccgctgcaggtgcccgacagcatccgcgacgacgcggccctgatgcgctatctc
gatgcgtggcggcccgcgtacgtgccgggcacgcgccgcacgtattcgaacgtcgcgctc
gggatgctcgggcaactcaccgcgaaggcgatgaacggcgacttcgcggcattgatggaa
cagcggctgttccccgcgctcgggatgacgcatacctatatcaacgtgcccgccgcacgc
cggggcgactatgcgcagggctatacgcaggacggcaagccgatccggatgacgggcggc
atgctgtggcagccggcgtacggcgtgaagacgacggcgaccgacctgttgcgcttcgtg
caggcgaacatggggctggtcgacacggcgccgcgtatgcagcgcgcgctcgagcgcacg
cacactggctatttccgtgcggggccgttcacgcaggacctgatctgggaacagtatccg
tatccggtcgcgctgccgacgctgctcgaaggcaacgggccggcgatgctccacggcgcg
acgcccgcgaccgaactcaagccgccgctcgcgccgcgcccggacacgtggatcaacaag
accggctcgaccaacggcttcagcacctatgtcgcgttcgtccctgcgaagcggatggcg
atcgtgatgctcgcgaaccgcagcttcccgatcgagaatcgcgtgaaagccgcgtaccgg
atcgtcgagtcgctgaacggcaagccgtaa

DBGET integrated database retrieval system