KEGG   Burkholderia ambifaria MC40-6: BamMC406_6065
Entry
BamMC406_6065     CDS       T00684                                 

Definition
(GenBank) FAD dependent oxidoreductase
Organism
bac  Burkholderia ambifaria MC40-6
SSDB
Motif
Pfam: DAO FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_2 FAD_binding_2 Pyr_redox_3 GIDA FAD_binding_3 Thi4 Pyr_redox Amino_oxidase Trp_halogenase AlaDh_PNT_C ScdA_N 3HCDH_N Lycopene_cycl
Other DBs
NCBI-ProteinID: ACB68501
UniProt: B1Z438
LinkDB
Position
3:631258..632583
AA seq 441 aa
MLAVLCSPVLPTMECLMRFGSYWLDTSEPFVSRSTERPDGNCDVVVVGGGITGSAAALAL
AKKGARVVVCEAGTVGQAASGRNGGMCNNGFAQDYASLSQRIGTELANRLYLAFDAGVDT
VERLVREESIDCDFARRGKLKLAAKPEHYDKLVRSHALLAASVDPDTRLVTKAELRDEIG
SNRYHGGLIFEKSAGMHVGRYVRGLANAAQARGAHILEHAPVLGMTREAGGAYAVRTPLG
EIRARQVLLASGISQVGPFGWIRRRIVPVGAFIIVTEPLPRELLDRLLPTRRMVTDTKNF
VNFFRVTPDNRMLFGGRARFAASNPRSDEKSGAILRQQMAAVFPELADVRIDYCWGGMVD
MTANRLPRAGERDGVYYSMGYSGHGTHMATLMGTLMAEIMDGRADLNPWKSFDWPAIPGH
FGKPWFLPFVGAWYRLKDTLQ
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgctcgccgtgctgtgcagcccggtgctgccgacaatggagtgcctgatgcgtttcggt
tcctactggctcgatacgtccgagccgttcgtgagccgctcgaccgagcggcctgacgga
aattgcgacgtggtggtggtgggcggcgggatcacgggttcggcggccgcgctcgcgctg
gcgaaaaagggcgcgcgtgtggtcgtctgcgaagcgggcaccgtcggacaggcggcgtcg
ggacgcaacggcggcatgtgcaacaacggcttcgcgcaggattacgcgtcgctgtcgcag
cgcatcggcacggaactggcgaaccggttgtatctcgcgttcgacgcgggtgtcgatacg
gtcgagcggctggtcagggaggagtcgatcgattgcgatttcgcgcggcgcggcaagctc
aagcttgcggcgaagcccgagcactacgacaagctcgtgcgaagccacgcgctgctcgcc
gccagcgtcgaccccgacacgcgcctggtgacgaaggcggaactgcgcgacgagatcggt
tcgaaccgctatcacggcggcctgatcttcgagaagagtgcggggatgcacgtcggccgc
tatgtgcgcggcctggcgaacgccgcgcaggcgcgcggcgcgcacattctcgagcatgcg
ccggtgctcggcatgacgcgggaggcgggcggcgcctacgcggtgcgaacgccgctcggc
gagatccgtgcgcgccaggtgctgctcgcgagcggcatctcgcaggtcggcccgttcggg
tggatccggcgcaggatcgtgccggtcggcgcgttcatcatcgtcaccgagccgttgccg
cgcgagttgctcgaccgcttgctgccgacgcgccggatggtcaccgacacgaagaacttc
gtgaatttctttcgcgtcacccccgacaaccggatgctgttcggcgggcgcgcgcgtttt
gccgcgtcgaatccgcgctccgacgaaaagagcggggcgatcctgcgacagcagatggcc
gccgtgtttcccgagctggccgacgtacgcatcgactattgctggggcgggatggtcgac
atgacggccaaccggctgccgcgcgccggcgagcgcgacggcgtttactactcgatgggc
tatagcggccacggcacgcacatggccacgctgatgggcacgttgatggccgagatcatg
gacggacgcgccgatctcaatccgtggaaaagcttcgactggcccgcgattcccgggcat
ttcggcaagccgtggtttctgccgttcgtcggcgcatggtatcgactcaaggacacgctg
caatga

DBGET integrated database retrieval system