KEGG   Burkholderia ambifaria MC40-6: BamMC406_6340Help
Entry
BamMC406_6340     CDS       T00684                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bac00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BamMC406_6340
Enzymes [BR:bac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BamMC406_6340
DNA repair and recombination proteins [BR:bac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BamMC406_6340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACB68772
UniProt: B1Z4V9
LinkDB All DBs
Position
3:complement(942882..945731)
Genome map
AA seq 949 aa AA seqDB search
MAGKLDPYRRKRHFGATPEPEGAHGRRTQAAAKAAARTRARGAHPLRFVIQEHHARRLHY
DFRLELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPLEYASFEGQIPEGHYGAGSVVVWD
EGTWTPDGGLAQAREGYRAGKLTFRLDGEKLHGGWALVRSGRQQGRQEQWLLIKERDDDA
RSMDEFDVVGERPGSVHDGAASARADAKNGSARARGSRQGRSEKPATRAARHDDRAHDGH
AGAPVDPSRIEGAVRAPLPEHVAPQLATLVDGPPTQGDWCYELKFDGYRILARISGKGAR
RHVKLMTREGRDWTAKLRAQRDALAALDVDAAWLDGEAVVLGKNGLPDFQALQNAFGGGH
SDEITLFVFDLPYLDGYDLRDAPLTARRALLEPLLADSDPTRLRFSPDLGDDVASLIASA
CDTGLEGLIGKRAESRYRAGRSPAWIKLKCRRRQEFVIGGYTEPSGSRHGFGALLLGVHE
PAADGKRRRGPGPLRYVGRVGTGFDTRMLDRLTPILRKHERDKMPFDPPPRERSRTPVHW
IEPVLVAECEFAEWTGDGIVRQAAFIALRDDKPAARIVREVPKHTETEVQMDQRETAQHE
RHKPGRTAHAGRDTGDTSDTSDTSDTSDTSDTSDGKHPARSRGSRRAEADDTGPDQLGRV
RISHPERVIDSHSGTRKIDLARYWQWVAPWLLPDLKGRPVSLVRAPGDISGELFFQKHAE
RREIPFVTQHDGLDPGHGPLLSLDSVDALLGAAQMGTIELHTWNAHASNIERPDRIVFDL
DPDPALPWSAMIDAAQLVRGLLDELGLISFCKTSGGKGLHVVVPITRHMGWDEVKDFSRA
VAQHVAGALPDRFTATMGPKHRRGKIFIDYLRNGRGASTIAAYSVRARPGLGVSVPLRWD
EVPDTTGGAQWTIDTLHERLDRLKRDPWDGYDDTRQRITAQMRARLGTS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagctcgatccgtatcggcgcaagcgccacttcggcgcgacgccggaaccc
gaaggcgcgcacgggcgccgtacgcaggccgctgcgaaggccgccgcgcgcacgcgcgca
cggggcgctcacccgctgcgcttcgtgatccaggagcaccatgcacggcgactgcactac
gacttcaggctcgaactcgacggcacgctgaaatcgtgggccgtgccgaaggggccgagc
ttcgatccgtcggtgaagcgcctcgcggtgcacgtcgaggaccatccgctcgaatacgcg
tcgttcgaaggccagattccggagggtcattacggcgcgggctcggtcgtcgtctgggac
gagggcacgtggacgcccgatggcgggctcgcgcaggcacgcgaaggctatcgcgcgggc
aagctgacgttccggctcgacggtgaaaagctgcacggcggctgggcgctcgtgcgcagc
gggcggcagcaggggcggcaggagcagtggctgctgatcaaggagcgcgacgacgacgcg
cgcagcatggatgaattcgacgtcgtcggcgagcggccgggcagtgtgcacgacggcgcg
gcgtcggcgcgtgcggacgcgaagaacggctcggcgcgcgcgcgcggttcacggcaaggg
cgcagcgagaagcccgccacgcgcgccgcgcggcatgacgaccgggcccacgacggccac
gccggcgcgcctgtcgacccttcccggatcgaaggcgcggtgcgcgcgccgctgcccgag
cacgtcgcgccgcaactcgcgacgctggtcgacggtccgccgacgcagggcgactggtgc
tatgaactgaagttcgacggctaccggattcttgcgcgcatttccggcaagggcgcgcgc
cggcacgtgaagctgatgacgcgcgaaggccgcgactggaccgcgaagctgcgcgcgcaa
cgcgacgcgctcgcggcgctcgatgtcgacgccgcatggctcgacggcgaggccgtcgtg
ctcggcaagaacggcctgcccgatttccaggcattgcagaacgcattcggcggcgggcat
tcggacgagatcacgctgttcgtgttcgacctgccttatctcgacggttacgacttgcgc
gacgcaccgctcaccgcgcgccgcgcgttgctcgaaccgctgctcgccgacagcgatccc
acgcggctgcgcttttcgcccgatctcggcgacgacgtcgcatcgctgatcgcgagcgcc
tgcgacaccggcctcgaagggctgatcggcaagcgcgccgagtcgcgctatcgcgccgga
cgctcgcccgcgtggatcaagctcaagtgccggcgccggcaggagttcgtgatcggcggc
tataccgagccgtcgggcagccggcacggcttcggcgcgctgctgctcggcgtgcacgaa
ccggccgcggacggcaagcggcggcgcgggccggggccgctgcgctacgtcggccgcgtc
ggcaccggcttcgacacgcggatgctcgaccggcttactcccatcctgcgcaagcacgaa
cgcgacaagatgccgttcgatccgccgccgcgcgaacgctcgcgcacgcccgtgcactgg
atcgagccggtgctcgtcgccgaatgcgaattcgcggaatggaccggcgacggtatcgtg
cggcaggccgcgttcatcgcgctgcgcgacgacaagccggcggcacggatcgtccgcgag
gtgccgaagcatacggaaacggaggtgcagatggatcagcgtgaaaccgcgcagcacgaa
aggcacaagcctggccgcacggcgcacgccgggcgcgacacgggcgataccagcgacacc
agcgacaccagcgacaccagcgacaccagcgacaccagcgacggcaaacaccccgcgcgc
tcacgcggctcccgtcgcgccgaggccgacgataccggccccgaccagctcggccgcgtc
cgcatcagccatccggagcgcgtgatcgattcgcacagcggcacgcgcaagatcgatctg
gcgcgctactggcaatgggttgcgccgtggctgctgccggacctgaagggccggcccgtg
tcgctcgtgcgcgcgccgggcgacatctcgggcgagctgttcttccagaagcacgcggag
cgccgcgagatcccgttcgtcacgcagcacgacgggctcgatccgggccatggcccgctg
ctgtcgctcgacagcgtcgacgcgctgctcggcgccgcgcaaatgggcacgatcgaactg
catacgtggaatgcgcacgcgtcgaacatcgagcggcccgaccggatcgtgttcgacctc
gatcccgatccggcgctgccgtggagcgcgatgatcgacgccgcccagctcgtgcgcggg
ctgctcgacgaactcggcctcatctcgttctgcaagacgagcggcggcaaggggctgcac
gtcgtcgtgccgatcacgcggcacatgggatgggacgaagtgaaggacttctcgcgcgcg
gtcgcgcagcatgtcgcgggtgcgttgcccgatcgcttcaccgcgacgatgggcccgaag
caccggcgcggcaagatcttcatcgactacctgcgcaacggccgtggcgcgagcacgatc
gccgcgtactcggtgcgcgcgcggcccgggctcggcgtgtcggtgccgctgcgctgggac
gaggtgcccgacacgacgggcggcgcgcaatggacgatcgacacgctgcacgaacgcctc
gatcgactgaagcgcgatccgtgggacggctatgacgacacgcgccagcggatcaccgca
caaatgcgcgcgcggctcggcacgtcgtga

DBGET integrated database retrieval system