KEGG   Bacillus sp. BH072: OY17_00655Help
Entry
OY17_00655        CDS       T03582                                 

Definition
(GenBank) ATP synthase F0F1 subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00190  Oxidative phosphorylation
bacb01100  Metabolic pathways
Module
bacb_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OY17_00655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bacb00194]
    OY17_00655
Photosynthesis proteins [BR:bacb00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   OY17_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Motif
Other DBs
NCBI-ProteinID: AJE76713
LinkDB All DBs
Position
complement(129294..129692)
Genome map
AA seq 132 aa AA seqDB search
MKTVKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDGQTEL
AAVSGGFLEVRPDQVTILAQAAETAESIDKERALAAKKRAEDRLNKRSDDTDIRRAELAL
QRAVNRLDVAGN
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgttaaagtcaatatcgttactcccgacggcccagtatatgatgctgatatt
gaaatggtaagtgtaagagccgagagcggtgatctcggtatcttgcctggccatattccg
accgtggctccgcttaaaatcggcgctgtccgccttaaaaaagacgggcagaccgaattg
gcggctgtcagcggcggatttttagaagtccgtcctgatcaggtcactatccttgcacaa
gccgctgaaacagcggaaagcattgataaagagcgcgcccttgctgcgaaaaagcgggcg
gaagaccgtttgaacaaacgatcagatgatactgacattcgtcgggctgagcttgcgtta
cagcgggctgtaaacagattggatgttgcaggaaactaa

DBGET integrated database retrieval system