KEGG   Bacillus sp. BH072: OY17_01105
Entry
OY17_01105        CDS       T03582                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00998  Biosynthesis of various secondary metabolites - part 2
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
Module
bacb_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    OY17_01105
Enzymes [BR:bacb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     OY17_01105
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-ProteinID: AJE76800
LinkDB
Position
complement(210278..211477)
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKEMEKTGAQIINLGQGNPDLPTPPHIVETLREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYLPDFERIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQANEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAAAALSGSPEHTERLKRTYKE
RIDFFTALCEKELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
GGKRYVRISMVAKQGDLREFVLRIQKLGLSFPSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagatggagaaaacgggagcccagatcattaatctcggccagggg
aatcccgatctccccactccgccgcatatcgttgaaactttgcgggaggctgcgctgaat
ccttcgtaccacggatacggcccgttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagagtacggggtatcggtcaatccggagacagaagtcgcgctgttc
ggcggagggaaagctggtttgtacgttttgacgcaatgcctgctgaaccccggcgatatc
gccttagtcccgaaccccggctaccctgagtatttatcgggcattacaatggccagagcg
gagctgcatgagatgccgcttcatccggaaaacggctatttgccggattttgagcggatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgacg
ggcgcaactgcggatcaggcgttttatgaaaaagcggcagcgtttgcaaaaaaacatgac
atccaccttattcacgattttgcatacggcgcgttcgaatttgatcagaacccggccagc
tttcttcaggcgaatgaagcgaaaacggtcggcgcggagctttattcattttcaaaaacc
ttcaatatggcaggctggagaatggcatttgccgtggggaatgagaaaatcattcaggcg
gtcaatgagtttcaggatcacgtattcgtcggcatgttcggcggtcttcagcaggcggca
gcggcggcgctgtcaggaagtcctgagcatacggagcgtctgaagcgcacatataaagaa
cggattgactttttcacggcgttatgtgaaaaggaattaggctggagcattgaaaaaccg
aaagggactttttatgtttgggctgaaattccaaatgaattcgagtcctcacaccagttt
tcggactatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggcagc
ggcggaaagcgttatgtcagaatatcaatggtggccaagcagggcgatttgagggaattc
gtgctgcggattcaaaagctcggtttgtcctttccttcattacaagaaacatcccgctga

DBGET integrated database retrieval system