KEGG   Bacillus sp. BH072: OY17_04500Help
Entry
OY17_04500        CDS       T03582                                 

Definition
(GenBank) peptide synthetase
  KO
K15655  surfactin family lipopeptide synthetase B
Organism
bacb  Bacillus sp. BH072
Pathway
bacb01054  Nonribosomal peptide structures
bacb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    OY17_04500
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OY17_04500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bacb01008]
    OY17_04500
Polyketide biosynthesis proteins [BR:bacb01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Surfactin family lipopeptide synthetase
    OY17_04500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AJE77400
LinkDB All DBs
Position
894665..905425
Genome map
AA seq 3586 aa AA seqDB search
MSKKSIQKVYALTPMQEGMLYHALLDPHSSSYFTQLELRIHGSFQLELFEKSVNELIRTY
DILRTVFVHQQLQKPRQVVLAERKTKVHYEDISQLDEARQTEYIERYKRGVQQQGFHLAK
DILFKAAVFRLSEKELYLVWSNHHIVMDGWSMGVLMKSLFQNYEALRAGRPAGGSQGKPY
SDYIKWLGGRDYEEAEQYWSSRLADFEQPSLLPGRLAAEKKDYQNEEYSFVWDEELVAQI
QQTANRHQVTGPNLFQAVWGAVLSKYNYTDDVVFGTVVSGRPSEINGIETMAGLFINTIP
VRIKIDKGAAFSDVMAAVQKNAVEAERYDYVPLYDIQKRSALDGSLLNHLVAFENYPLDK
ELENGGMEERLGFSIKVEHAFEQTSFDFNLIVYPGKTWTVKIKYNGAAFAHDAIERTAHH
LTRMMKAAVGTPDAPVRELGLVSGEEERQIVEVFNDTKTALPEEEAVHRLFEEQANRTPA
SIAIKEAGREWTYREVNEAANRLARHLVKSGLEKGRTAAIMNDRSAETVVGMLAVLKAGG
AYVPIDPAFPEDRLRFMAEDSSIRLVLTVQDYQEQAGALQVPVVMLDERADETVSGTDLN
LPAGGNDLAYIMYTSGSTGKPKGVMIEHRNIIRLVKHSNYVPVHEEDRMAQTGAVSFDAG
TFEVFGALLNGASLHPVKKETLLDAGQFAQFLKEQRITTMWLTSPLFNQLAQKDAGMFNT
LRHLIIGGDALVPHIVSKVRKASPELSLWNGYGPTENTTFSTSFLIDQDYDGSVPIGKPI
GNSTAYIMDENRNLQPIGAPGELCVGGSGVARGYVNLPELTEKQFVRDPFRPDEMIYRTG
DLAKWLPDGTIEFLGRIDNQVKVRGFRIELGEIEAKISQAENVTESAAVIRKNKADENEI
CAYFTADQALSPEDLRKTLSESLPEYMIPAHFIQMNQFPLTANGKIDKKALPEPQAEAVQ
KEYVAPKTEAEQKLADIWEGILGVKAGVTDNFFTIGGHSLKAMMMTAKIQEHFQKEVPIK
VLFEKPTIQELAHYLQHESEEEQQFEPIRQAPYQKHYPVSSAQRRMYILNQLGQASTSYN
VPAVLLLEGSVDKKRLEEAMQALINRHETLRTSFDMADGEVVQTIHKNVSFELETAEGRE
EDAEELTKDFIRPFALNRAPLVRSKLIRLEEDRHLLLIDMHHIITDGSSMGIFIGDLAKL
YQGTELALPKIHYKDFSVWQREKANLDQHEAYWLDTFKGDLPVLDLPLDFPRPAERSFEG
ERVIFGLDKQVTAQIKKLLADTDTTMYMFLLAAFQVLLSKYSGQEDIVVGSPAAGRQHPD
LQDVPGMFVNTVALRSHPIGKKTFKQFLDEVKTASLQAFEHQSYPLEELIEKLPLTRDTS
RSPLFSVLFNMQNMEIPALRLGDLEISSYSMHHHVAKFDLSLEAAERGEEVGLSFDYAKA
LFADETIRRWSAHFVNLIKACAENPDIQLADASLLSAPEREALLSDEKRTEADLPEGTFV
SLFERQAQKTPDLTAVAGGTSLTYRELDERSNRFARHLQACGTGSEDIVAIMMDRSADLI
TAILGVMKAGAAFLPIDPETPEERIRYSLEDSGTKLLVVNERNMTAAAVYKGKTVVMEDG
EWQNESADRLETEPGADQLAYIIYTSGTTGKPKGVQLEHRNLINYVTWFSREAGLTEADK
SVLLSSYAFDLGYTAIFPILQAGGELHIVPKETYTAPDQLGEYIQKNGITYMKLTPSLFH
MIVNTARFAAERRFSPLRLVVLGGEKIITSDVRKFHDVYAHTDFINHYGPTETTIGAIAG
RINMERLDQYEQRPVIGRPIANTGALVLDGAMQLVPPGASGELYITGKGLARGYLHRPQL
TAEKFLSNPFSPDSLMYKTGDVVRRLPDGTIEFIGRADDQVKIRGYRIELKEVETVLLSV
NGIQEAVVLAVSEGGLPELCAYYKAGSELKGSELRKRLSETLPSHMLPAYFVQVDRIPLT
ANGKTDKNALPKPGVSQTAQTASALPETELEEKLCRIWKQTLGTDTLGIDDNFFDYGGHS
LKGMMLLANIQAELDKTVPLKALFEQPTVRLLAAYIEKSAVSEGYRMISPADSADAYPLS
SAQKRMYVLNQLDRETISYNMPSVLLMEGEVNISRLQEALNQMINRHESLRTSFIDQNGR
PMQQIAEQADIDLHIFEAADEEKADLIIQAFIKPFDLSAAPLIRAALVRLNEKKHLLLLD
MHHIIADGVSRSMLVKELAHLYKGGSLPSPNLHYKDFAVWQNEPEQAERMKDHERYWLSA
FSGELPELNLPTDFPRPPVQSFKGQSVRFRAGRETEKAVRELMESSGATLHMVLHAAFHV
FLSKITGQRDIIIGSVTAGRTSAEVQEMPGMFVNTLALRNETRKEQTFAGLLEQVKQTNL
DALAHQDYPFEDLIGKLDLPRDMSRNPLFQVMVTTEDPDKETLELENLRITPYESNQGTA
KFDLTLGGFTDQEGLGLQFEYAADLFKKETIEKWSAGFLRILKQAAESPDRKLPEISLIS
DAEKQALLDEWKGKTISVPRDKTVHRLFEETAARYADRPAAAYNGAKWTYGELNARANRI
ARILMDCGVTADERVGILTKPSLEMAAGVLGVLKAGAAFVPIDPDYPEERISYILQDSGA
KLLLTQEALGVPDSYKGETILLDGGRSILSLPLDENDEANPQTETTADHLAYMIYTSGTT
GQPKGVMVEHHALVNLCFWHHDAFAMTADDKSAKYAGFGFDASIWEMFPTWTIGAELHVI
DEAIRLDITRLNHYFEEHGVTITFLPTQLAEQFMELENTSLRMLLVGGDKLKRAVKQPYT
IVNNYGPTENTVVATSGVINPEEGSLSIGRAIANTRAYILGDGDQVQPEGIAGELCVAGR
GLARGYLNREEETAKRFTADPFVPGERMYRTGDLVKWNAQCGIEYIGRIDQQVKVRGYRI
ELSEIEVRLAQLADVHDAAVTAVEDKAGNTALCAYVAPQQDDIETLKAALKDTLPDYMVP
AFWVEMDELPVTANGKIDKKALPEPDIEAGSAAYKAPETEMETLLSDIWQEVLGLDQIGV
SDNFFTLGGDSIKGIQMASRLNQHGYKLEMKDLFQHPTIEELVSYVERTEGKQADQGPVE
GEADLTPIQRWFFEKNFTDKHHWNQSVMLHAKDGFDPDLVEKTLQALIEHHDALRMVYRE
EREGIIQTYLPVTECKASFDIVDLYGTDEDMLKSQIQRLADHLQGSLDLENGPLLKAEQY
RTEQGDHLLIAVHHLVVDGVSWRILLEDFASGYKQAQQQNSIVLPQKTHSFKDWAEALNT
FAQSEELKKQADYWAEADAEELRPLPKDHDPNKRLVKHTAAVKCELTEEETAQLLTDVHH
PYGTEINDILLSALGLTIGEWTENGKVGINLEGHGREEIIPNVNISRTVGWFTAQYPLIL
QISKEDGVSSVIKTVKETVRRVPDKGVGYGILRYLSSDETEKGAAPEISFNYLGQFDNEV
KTEWFEPSPYDMGRQVSEESEALYALSFSGMVTGGRFVISCSYNQEEYERSTVETQMQRF
KDNLLMIIRHCTAKEEKEFTPSDFSAQDLEMDEMGDIFDMLEENLT
NT seq 10761 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaatcgattcaaaaggtgtatgcactcacaccgatgcaggagggaatgctg
tatcatgcgctgcttgatccgcattcttcctcctacttcacacaattagagcttaggatt
cacggaagctttcagctggagctttttgaaaaaagcgtcaatgagctgatccggacatat
gacattttgcgtacggtattcgtgcaccagcagcttcaaaaaccgcgccaagtcgtattg
gcggagcggaagacgaaggtgcactatgaagatatcagtcaattagatgaagcgcgccaa
actgagtatatcgaacgctataaacgcggcgtgcagcagcagggctttcatctggcgaag
gatattctctttaaagcggcggtgttcagactcagtgagaaggagctgtatctcgtctgg
agcaatcatcatatcgtcatggacggctggagtatgggcgttttgatgaaaagcctgttt
caaaactatgaagcgcttcgtgccggccggcccgccgggggaagccagggcaaaccttac
tctgactatatcaaatggctcggaggccgggattatgaggaggcggaacaatattggagc
agccgcctggcggatttcgaacagccgagcctgctcccgggccgtctggcagcagaaaag
aaagactaccaaaatgaagaatattcttttgtctgggatgaagagctggtcgcgcagatt
cagcagaccgccaaccggcatcaagtcacggggcctaacctgtttcaggccgtttggggt
gcggtgctcagcaaatacaactatacagacgatgtggtgttcggcaccgtcgtatcaggc
cgtccttcagaaatcaacggcatagaaacgatggcggggctgttcatcaatacgattcct
gtcagaatcaagattgacaaaggtgcagccttttcggacgtgatggcggcagttcagaaa
aacgccgtggaagccgagcgctatgattatgtgccgctctatgacattcaaaagcgctcc
gccctggacggcagcctcttaaatcatttggtcgcgtttgaaaactatccgctggacaaa
gagctggaaaacgggggcatggaggaaagactcggcttttccattaaagtggaacatgct
tttgagcagacgagctttgatttcaatcttatcgtgtatccgggaaaaacgtggactgtc
aaaatcaaatacaatggagcggctttcgctcatgatgccatcgaacgaacggcgcaccat
ctgacccgcatgatgaaagccgcggtcggaacgcctgacgcgcccgtgcgggaactcggc
cttgtttcaggcgaagaagagcggcagattgttgaggtattcaatgatacgaaaacggct
cttccggaagaggaggccgttcaccgtttgtttgaagaacaggcaaaccggacgcctgca
agcatcgcgataaaagaagcgggacgcgaatggacctaccgtgaagtgaacgaagcggcc
aaccgcctggcgagacaccttgtgaagagcggactggaaaaaggccggaccgccgctatt
atgaacgaccggtctgcggaaaccgttgtcggaatgcttgccgtcctaaaagcaggcggc
gcatatgtgccgattgatccggcttttccggaggaccgtctccgctttatggcggaagac
agctcgattcggctcgtgctgacagttcaggactatcaagaacaagcgggcgcattgcaa
gtcccggtcgtcatgctggatgaaagggcggatgaaacggtaagcggaacagacttgaat
cttccggccggcggcaacgacttggcgtatatcatgtatacatccggatcgaccggcaaa
ccgaaaggcgtcatgattgaacacagaaatatcatcaggctcgtcaaacattcgaattac
gtgccggtgcatgaagaagaccggatggcgcaaacgggagccgtcagctttgatgccgga
accttcgaagtcttcggcgcattgctgaacggagcgtcattgcacccggtgaaaaaagag
acgctgcttgacgccggacaattcgcccaatttctgaaagagcagcggatcacgaccatg
tggctgacgtctccgctgtttaatcagcttgcccaaaaggatgccggcatgtttaacacg
ctccggcacctcatcatcggcggtgatgcgcttgtgccgcatatcgtcagcaaagtgagg
aaggcatcaccggagctgtcgctttggaacggctacgggccgacggagaatacgacgttt
tcgacgagttttctcattgatcaggattatgacggttcggtcccgatcgggaagccgatc
ggaaattccactgcgtacattatggacgaaaaccgcaacctccagccgatcggcgcgccg
ggtgagctgtgcgtcggcggaagcggagtggcaagaggctatgtgaatctgcctgaatta
acggagaagcagtttgtacgcgatccgttcagaccggatgaaatgatataccggacgggg
gacttggcgaaatggcttccggacggcacgatcgagtttctcggcagaattgacaaccaa
gtaaaggtccgcggtttcagaatcgagctcggcgaaatcgaggcgaaaatcagccaggcg
gagaatgtgacggaatctgcggctgtgatccggaaaaataaagcggatgaaaatgaaatc
tgcgcttactttaccgcagaccaagccctttcgccggaagacctgcgcaaaacgctttcg
gaatcacttccggaatacatgattccggcgcacttcatccagatgaatcagtttccgctg
acggcgaacggaaagattgataaaaaagcgctgcctgagcctcaggctgaagccgttcaa
aaagaatacgtagcgccgaaaacggaagcggagcagaaactcgcggacatttgggaaggc
attctcggtgtaaaagcgggtgtgactgacaatttcttcacgattggcggacattcttta
aaagccatgatgatgaccgctaaaatccaggagcactttcaaaaagaagtgccgattaaa
gtgttatttgaaaagccgaccattcaggagcttgcgcattatttgcagcatgagagcgag
gaggagcagcagtttgaaccgatccgacaagcgccttatcagaagcattatcctgtttcc
tcagcacagcgcaggatgtatatccttaatcagctcggacaggccagcacgagctacaac
gtccctgctgtacttctgctggaaggatcagtagacaaaaagcgtcttgaggaggccatg
caggcattaatcaaccgtcatgagaccttgcgtacgtcgtttgacatggcagatggagaa
gttgtgcagaccattcataaaaatgtgtcgtttgagcttgaaaccgccgagggccgggaa
gaagatgcagaagagctgacaaaagactttatcaggccttttgcgctcaaccgcgcgccg
cttgtccgttcgaagctgatccggcttgaagaagaccggcatcttctgctgattgacatg
caccacattattacggacggaagctcaatgggcattttcatcggtgatcttgcgaagctt
tatcaaggcacggagcttgcactgccaaagattcattataaggatttttcagtctggcag
cgtgaaaaagcaaatctcgatcagcacgaagcctactggcttgatacgttcaaaggcgat
ctgccggtgctggatctgccgcttgatttcccgcgtcctgctgagcgcagttttgaaggg
gaacgcgtcatcttcgggcttgataaacaggtgacggcgcagattaagaagctgctggct
gatacggatacgacgatgtacatgttcttgttagccgcttttcaagtgctgctgtccaaa
tattcggggcaggaagacatcgtagtcgggtctccggcggccggaagacagcatcctgat
ctccaagacgtgccgggcatgtttgtcaacacagttgcgcttcggtcgcatcctatcggc
aaaaaaacgttcaaacaatttctggatgaggtgaaaacggcgagccttcaagcttttgag
catcaaagctatccgcttgaagaattaattgaaaaactgccgttaacgagggacacaagc
cggagtccgctgttcagcgtgttatttaatatgcagaacatggagatcccggccctgcgg
ctcggagatttggagatttcttcatactccatgcatcatcatgtcgctaaatttgatctt
tccttagaagcggctgaacgcggagaagaggtcggattgagctttgattacgcgaaagcc
ttatttgcggacgaaaccatccgccgctggagcgctcattttgtcaatctgattaaagcc
tgcgctgaaaatccggatattcagctggccgacgcaagcctgctgtccgctcctgaacgg
gaagcgctcctttctgatgaaaaacgtacggaagcggatctgcctgagggcacttttgtt
tcgctgtttgaacggcaagcgcaaaaaacgcctgatctcacggcggttgcgggcggaaca
agtctgacatatcgtgagcttgatgaacgctcgaaccggtttgcccgccaccttcaggct
tgcggaacgggcagtgaggacatcgtggccattatgatggatcgttcggccgacttgatt
accgcgattctcggcgtcatgaaagccggagcggcatttctcccgattgatccggagact
cctgaagagagaatccgctactctcttgaagacagcggaacgaagcttctggtcgtcaat
gagagaaacatgaccgcggccgccgtttataaaggaaaaacggtcgtaatggaagacgga
gaatggcagaacgaaagcgccgatcggcttgaaacggagcccggcgccgaccagcttgca
tatatcatttatacctcgggaacaacgggcaaaccgaaaggcgtccagctggagcaccgc
aatctaatcaattatgtcacatggttcagccgtgaagccggtttgaccgaagctgacaaa
tctgtgctgctgtcttcttacgcatttgatctcggctatacggctatattcccgattctt
caggcgggcggagagctgcacattgtgccgaaagagacgtacaccgcgcctgatcagctt
ggtgagtatatacagaaaaacggcattacgtatatgaaactgacgccgtcattgttccat
atgatcgtcaatacagcccgctttgcggcagaacgccgtttcagcccgcttcgtttagtg
gtgctcggcggagaaaagatcatcacgtccgatgtccgcaagtttcatgacgtatacgcc
cataccgacttcatcaatcactacgggccgacggaaacgacgatcggcgccattgcggga
cggatcaatatggagcgccttgatcaatatgagcagcgtcccgtcatcggccgcccgatc
gcgaataccggcgcgcttgtattggacggagcaatgcagctcgttcctccgggcgcaagc
ggcgagctttatattaccgggaaggggcttgccagaggatatcttcaccgtccgcagctg
acggcggagaaatttctctcaaatcctttttcaccggacagcctcatgtacaaaacggga
gatgtcgtccgcaggcttcctgacgggacgattgaatttatcggccgtgcggatgatcag
gtgaaaatccggggctaccgcattgaattaaaagaggttgaaaccgtgctgttaagcgta
aacggcattcaggaggcggtcgttctcgcagtcagcgaaggcgggctgccggaactgtgc
gcgtactataaagccggcagcgagctgaaaggctctgagcttcgcaaacggctttccgaa
acactgccgtctcatatgctcccggcctatttcgtgcaagtagaccgcattccgctcaca
gccaacggaaaaaccgataaaaacgccctcccgaaaccgggcgtcagccaaacggcgcaa
acagcttcagccttgccggaaacggaattggaggaaaaactgtgccgcatttggaaacag
acactcggtacggatacgctcggcatcgacgataatttcttcgattacggcgggcactct
ttaaaaggcatgatgctcctcgccaatattcaggctgaactggacaaaacggttccgtta
aaagcgctgttcgaacagccgactgtccgcctgcttgccgcatatatcgaaaaatcagcg
gtatctgagggatatcggatgatctcaccggcagacagtgcagacgcgtacccgttatca
tccgcccaaaaacggatgtacgtcctgaaccagcttgaccgggagacaatcagctataat
atgccgtccgttcttctgatggaaggagaagtcaatatttcaaggcttcaggaagcgctc
aatcagatgatcaatcgccacgagtctttgcggacgtcctttatcgatcaaaacggccgc
ccgatgcagcagatcgcagaacaggctgacatcgacctgcacatctttgaagcagcagac
gaggagaaagcggatcttatcattcaggcattcattaagccgtttgatctgagcgcggct
ccgctcattcgggccgctcttgtcagactgaatgaaaagaaacacctgctgctgctggat
atgcatcatattattgccgacggcgtatccagaagcatgctggtcaaagagctcgctcat
ctttacaaaggcgggagcctgccgtcgccgaacctgcactataaagacttcgccgtctgg
cagaatgaacctgagcaggccgaacggatgaaagaccatgagcgttattggctctccgca
ttttccggcgagcttcctgaattgaatctgccgaccgatttcccccgtccgccggttcaa
agttttaaaggacaatccgtccgtttcagagcggggcgtgaaacggaaaaagcggtgcgt
gaattaatggaatcatcgggagcgactcttcatatggtgcttcacgccgcgttccatgtc
tttttgagcaaaatcacggggcagcgcgatatcattatcggctcggtgaccgccggaaga
acgagcgccgaagttcaggaaatgccggggatgtttgtcaatacgcttgcgcttcgcaat
gaaacgcgcaaagagcaaaccttcgccgggctgctcgaacaggtgaaacaaaccaatctc
gacgcgctggcgcatcaggattatccgtttgaggatctgatcggaaagcttgacctgccg
agagatatgagccgaaatccgttgttccaagtcatggtgacgacagaagatccggataaa
gaaacactggaactggagaacctgcgcatcactccgtatgagtcgaaccaaggcacggcg
aaattcgatctgacactcggcggctttacggatcaagaaggtctcggccttcagtttgaa
tatgcggctgatctgtttaaaaaagaaacaattgaaaagtggagcgccgggttcctgcgg
attctgaagcaagcggcagaaagtccggacagaaagctgcctgagatttcactgatcagc
gatgctgaaaaacaagccctccttgacgaatggaaaggaaaaacaatttctgtgccgcgg
gacaaaacggttcaccgtctctttgaagaaacggccgcccgctacgcggaccggccggcc
gcggcatacaacggcgcgaaatggacgtacggcgagctgaacgcaagggcgaatcgcatc
gcgcgcattctcatggactgcggcgtcacggctgacgagcgtgtcggcatcctgacgaaa
ccgtccttggaaatggccgcgggcgtactcggcgtcctgaaagcgggcgcggcatttgtg
ccgattgaccccgactacccggaagagcggatcagctacattctgcaggacagcggcgcg
aagcttcttctcacacaggaagcgctgggcgtgccggacagctacaaaggagaaacgatc
ctgcttgacggcggacgctccattctgagcctgccgcttgatgaaaatgatgaagcgaac
ccgcagacggaaacaacggcggatcatctcgcttatatgatttacacgtcaggaacgacc
ggacagccgaaaggtgtcatggtcgaacaccatgcgctggtgaacctgtgcttctggcat
cacgacgcattcgccatgacggcggatgataaaagcgccaaatacgcgggcttcggtttt
gacgcctccatctgggagatgttcccgacatggaccatcggcgcggaacttcacgtcatt
gacgaagcgatccggctggatatcacccgcttaaatcactatttcgaagagcacggcgtg
accatcaccttcctgcctacgcagctcgccgaacaatttatggagctggaaaatacctct
ctccgcatgcttctcgtcggcggcgataagctgaagcgggcggtgaaacagccgtacacg
atcgtcaacaactacggcccgacggaaaacaccgtcgtcgcgacaagcggcgtcatcaat
ccggaggaagggtcgctttcgatcggacgggcgattgccaatacgagagcttatattctc
ggcgacggcgatcaggtgcagccggaaggcattgccggtgaattatgcgtggcaggccgc
ggacttgcgcgcggatacctgaaccgtgaagaagaaacggcgaagcggtttaccgccgat
ccgttcgtgcccggcgagcgcatgtaccggaccggcgacctcgtcaaatggaacgcgcag
tgcggcatcgaatacatcgggcgtatcgaccagcaggtcaaagtgcggggctaccggatc
gagctttcagaaatcgaagtccgcctcgcccagcttgcggacgttcatgacgcagcggtg
acggcggtggaagacaaagcgggcaataccgcgctttgcgcctatgtcgcgcctcagcag
gacgatatcgaaacgctcaaagccgcgctgaaagacacgctgcctgactacatggtgccg
gcgttctgggtggagatggacgagcttccggtcaccgcaaacggaaagattgacaaaaaa
gccctgccggaaccggacattgaagcgggaagcgccgcgtacaaagcgccggaaacggag
atggagacgctgctttctgacatttggcaggaagtgctcggtcttgaccagatcggcgta
agcgataatttcttcacgctcggcggcgactcgatcaaaggcatccaaatggcgagccgc
ctgaaccagcacgggtataaattggagatgaaagacctcttccagcacccgaccatcgaa
gaactcgtctcttatgtggagcggacggaaggcaagcaggccgaccagggccctgtcgaa
ggtgaagcggacttaacgccgatccagcgctggttctttgagaaaaacttcacggacaaa
caccactggaatcaatccgtcatgcttcacgcgaaagacggctttgatccggacctggtg
gaaaaaaccctgcaagcattgattgaacaccatgatgcgctccgcatggtttaccgtgaa
gaaagggaaggcatcattcagacatacctccctgtcacagaatgcaaggcaagctttgac
atcgttgatctgtacggaactgacgaggatatgctgaaaagccagattcagcggcttgcc
gatcatcttcagggaagtctggatctggagaacggcccgctgttaaaagcggagcaatac
cggacagaacaaggcgatcatctgttaatcgcggttcaccatctcgtcgtggacggggtt
tcatggagaattctgcttgaggatttcgcttcaggttataaacaggcgcagcagcaaaac
agcatcgtcctcccgcaaaaaacccactcctttaaagattgggcggaggcgctgaacaca
tttgcgcaatcagaagagctgaaaaagcaggcggattattgggcggaggcagatgcggaa
gaactccggccgctgccgaaagaccatgatccgaacaaacggctcgtcaaacatacggcg
gccgtgaaatgtgaattaactgaggaagaaacggcacagctgcttacagatgttcatcat
ccgtacggaacggaaatcaacgacattctgctcagcgcgctcggcttaacgatcggtgaa
tggacggaaaacggcaaagtcggcatcaacttagaaggacacggccgggaagaaatcata
ccgaatgtcaatatttcacggacggtcggctggtttactgcccaatatcctttgattctg
caaatcagcaaggaagacggcgtctcttccgtcattaaaacggtaaaagagacggtgcgg
cgcgttcctgataaaggtgtaggatacgggattctccggtatctgtcatccgatgaaaca
gaaaaaggcgccgcgcctgaaatcagttttaactacttagggcagtttgacaatgaagtg
aaaacggaatggtttgagccgtctccatatgatatgggacgtcaagtcagcgaagaatca
gaggcgttatacgcactgagcttcagcgggatggttacaggcggccgcttcgtcatttcc
tgctcatacaatcaggaagaatatgaaagaagcaccgtcgaaacacagatgcagcggttt
aaagacaatctcttaatgatcatccgccattgcacggccaaagaagagaaagaatttacg
ccgagcgatttcagcgcgcaggatcttgagatggatgaaatgggagacatctttgacatg
cttgaggagaatttaacgtga

DBGET integrated database retrieval system