Bacillus sp. BH072: OY17_05550 Help Entry OY17_05550        CDS       T03582                                  Name (GenBank) hypothetical protein   KO K06440   similar to spore coat protein Organism bacb  Bacillus sp. BH072 Brite KEGG Orthology (KO) [BR:bacb00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     OY17_05550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF892 Motif Other DBs NCBI-ProteinID:  AJE77592 UniProt:  A0A806QDN5 LinkDB All DBs Position complement(1103114..1103320) Genome browser AA seq 68 aa AA seqDB search MASALHELLEIQEMASFKSLCLTKSKTMKALVSDPQLKEIMQQDVDTSTRQLQEFASILS DAQHEMRR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggccagcgccttacatgaattactcgaaattcaggagatggcttcttttaagtcactt tgtctgacgaaatccaaaaccatgaaagcgctcgtatccgatccgcagctgaaagaaatc atgcagcaggatgtggatacatcaacaaggcaattgcaggaatttgcctcgattttatct gatgcacagcatgaaatgaggagatga

DBGET integrated database retrieval system