KEGG   Bacillus sp. BH072: OY17_06745Help
Entry
OY17_06745        CDS       T03582                                 

Definition
(GenBank) PhoP family transcriptional regulator
Organism
bacb  Bacillus sp. BH072
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AJE77811
LinkDB All DBs
Position
1357827..1358540
Genome map
AA seq 237 aa AA seqDB search
MKEIRVLIADDEKVIRDLLKKYIERELYLADVAKDGQEALALFEQNTYHLVILDLMMPKM
DGIEVCRKLREKTNVPILMLTAKDHEADKIVGLSIGADDYITKPFSVNEVVARIKALMRR
FFILGSGSGTEEKPLLKYKGLSIDVKRYIVCVAGEEISLTAKELELLKFMASNPEQVFTK
AQLFRNVWGNHYLEDDNTVMVHIRKLRKKIEKDPSNPQFIQTVWGIGYKFAGEKDES
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattcgtgtccttatcgctgatgatgaaaaagtgatcagagatttattaaaa
aaatacattgaacgggaactttatttagcagatgttgcaaaggatggacaggaagctttg
gcattatttgaacaaaatacttatcacctcgtaatattggatctcatgatgccaaaaatg
gatgggattgaagtatgcagaaaactaagagaaaaaaccaatgtgccaatacttatgctt
actgcaaaggaccatgaagctgacaaaattgtagggttgagtataggagcagatgattat
attacaaaaccttttagcgtaaacgaggttgtggccagaattaaggctctgatgagaagg
tttttcattttagggagcggcagcggaacagaagagaagccgctgctgaaatataaaggt
ttatcaattgatgtgaaaagatatatcgtatgcgttgcaggtgaagaaatatcattaacc
gcaaaagagctggagctgctgaaatttatggcttccaatccggaacaggtatttacgaag
gctcagttgtttcggaatgtttggggcaatcattacttagaagatgacaataccgtgatg
gttcacataagaaagctgagaaaaaaaatagaaaaagacccatctaatcctcaatttata
caaacagtttggggaataggatacaaatttgcaggtgagaaagatgagtcgtaa

DBGET integrated database retrieval system