KEGG   Bacillus sp. BH072: OY17_07275Help
Entry
OY17_07275        CDS       T03582                                 

Definition
(GenBank) epoxyqueuosine reductase
  KO
K18979  epoxyqueuosine reductase [EC:1.17.99.6]
Organism
bacb  Bacillus sp. BH072
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacb03016]
    OY17_07275
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     OY17_07275
Transfer RNA biogenesis [BR:bacb03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    OY17_07275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1730 Fer4_16 HEAT_2 HEAT_PBS Fer4_10 Fer4_9 Fer4_6 Fer4 HEAT_EZ Fer4_21 Fer4_7 HEAT Fer4_3 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AJE77892
LinkDB All DBs
Position
1449208..1450368
Genome map
AA seq 386 aa AA seqDB search
MNIHKLKEELIEYAKSIGVDKIGFTTADTFDSLRDRLILQESLGYLSGFEEPDIEKRVTP
SLLLPKAKSIVAIALAYPSKMKDAPRSTRDGRRGIFCRASWGKDYHDVLREKLDLLENFL
QSKHEDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNLPFEP
DVPIEDMCGTCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGC
DTCQTVCPINKGKDFHLHPQMEPDPEIAKPLLKPLLTISNREFKEKFGHVSGSWRGKKPI
QRNAILALAHFKDASSLPELTALMHQDPRPVIRGTAAWAIGKIGDPDYAEELEKALQKEQ
DEEAIREIEKGLELLSVSDKTKTGRS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcataaactgaaagaggagttaatcgaatacgccaaaagcatcggagttgac
aaaatcgggtttacgacggctgatacgttcgacagtctgcgggaccggctgattcttcag
gaatcactcggctatttatccggttttgaagagccggatattgaaaaacgggtcactccg
tctttgcttctgccgaaagccaaatcaatcgtcgccatcgcccttgcttatccttccaaa
atgaaagatgcgccgaggagcacgagggacgggcggcgcggcattttttgcagagcttcc
tgggggaaggattatcatgatgtgctgcgggaaaagcttgatcttctggaaaattttctc
caaagcaaacatgaggatatccgcacaaagtcaatggtggatacaggagaattgtccgac
agggccgtggctgaacgggcgggaatcggcttcagcgccaaaaactgcatgatcaccacg
cctgaatacggttcttacgtctatctggctgaaatgatcaccaatctgccctttgaaccg
gatgtgccgattgaagatatgtgcggtacgtgcacaaaatgtctagacgcttgtccgacc
ggcgcactcgtcaatcccggacagcttaacgcccagcgctgtatttcgttcctgacccag
acaaagggatttttgccggatgagttccgcacgaaaatcggaaaccgtctgtatggctgt
gacacgtgccagacggtctgtccgattaataaggggaaagattttcatcttcatccgcag
atggagcctgatccggaaatcgcaaagccgctgttaaagccgcttttgaccataagcaac
cgcgaattcaaagaaaaattcggacatgtatcgggatcatggcgcggcaagaagccgata
cagcggaatgcgattttagctttggctcattttaaagatgcctcgtctcttccggaatta
acggccttgatgcaccaagatccgcgccccgtcatcaggggtacggccgcctgggccatc
gggaaaatcggtgatcctgattatgcggaggaattagaaaaagcgcttcaaaaggagcag
gatgaggaagccatacgggaaattgaaaagggactggagctgttatcggtttctgataag
actaaaaccggccggtcctga

DBGET integrated database retrieval system