KEGG   Bacillus sp. BH072: OY17_07460Help
Entry
OY17_07460        CDS       T03582                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00564  Glycerophospholipid metabolism
bacb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OY17_07460
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OY17_07460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored Cation_ATPase_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJE77927
LinkDB All DBs
Position
1484629..1486296
Genome map
AA seq 555 aa AA seqDB search
MMNHQFSSLERDHMLEDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGT
SSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFS
TSIGLRVYDYLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEV
MKEAVKFGAEPVNYSKVKELLYEKGKVVGVLIEDLLSGKEYKVYAKKIVNATGPWVDELR
EKDHSKSGKHLQHTKGVHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVY
KQKLEHPRMTVQDRDYVVSSINYMFPELNITADDIESSWAGLRPLIHEEGKDPSEISRKD
EIWTSQSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGGQDFGGCKTKTMPISGGHVGG
SKNFESFVEAKTKDGLKIGLSQETAKQLAIRYGSNVENVFSRIEGLKDEAEKRQIPVHIL
AEAAYSIEEEMAATPADFFVRRTGRLFFDIKWVQTYKTAVIDYMSDRFQWNDATKEKHTE
WLNTLLHDAVVPLEQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaccaattttcaagtttggaacgggatcatatgctggaagacatgactaaa
aaaacatacgatctgtttattataggcggaggtattacgggtgccggtacggcgcttgac
gcagcttcaaggggaatgaaagtcgctttgagcgaaatgcaggatttcgcggccggcaca
tcaagccgatccacaaagcttgtccacggcggtttgcgttatctgaagcaatttgaagtc
aaaatggttgcagaagtcggtaaggaacgtgccatcgtgtacgaaaacggcccgcacgtc
acgacgccggaatggatgctgctgccgtttcataaaggcggcacgttcggttcattctct
acttccatcggcctgcgtgtgtatgactatttagcgggagtaaaaaaatcagagcgcaga
agcatgctgtctgctaaagaaacgctgcaaaaagagccgctcgtcaaaaaagacggctta
aaaggcggaggctattatgtagagtaccggacggacgatgcgagactgacgattgaagtc
atgaaagaagccgttaaattcggtgcggagcctgtcaactactctaaagtgaaagaactg
ctttatgaaaaaggaaaagttgtcggcgttttaattgaagatctgctgtcaggcaaggaa
tacaaagtttacgccaaaaaaatcgtcaatgcgacaggtccgtgggtcgacgagctgaga
gaaaaagaccacagtaaaagcggaaaacatcttcagcacacaaaaggggtccatctcgta
ttcgaccaatccgtattcccgcttaaacaggcggtatactttgatacgccggacggccgg
atggtgttcgccattccgcgtgaaggaaaaacatacgtgggtacgaccgatacggtttac
aaacaaaaacttgagcatccgcgcatgacggtgcaggatcgcgattatgtcgtcagctcc
atcaattatatgttcccggaactgaacattacggcggacgatattgaatcaagctgggcc
ggcctcagaccgcttattcacgaagaagggaaagacccgtctgagatctcccgtaaagat
gaaatctggacatctcaatcaggcctgattacgatcgccggaggaaaactgacgggctac
cgtaaaatggctgagcacattgtcgatcttgtccgcgaccgcttgaaagaagagggcggc
caggacttcggcggctgcaagacgaagacgatgccgatttccggcggacatgtcgggggc
tctaaaaacttcgagtcatttgtggaagcaaagacaaaagacggcttgaaaatcggttta
tcacaggaaaccgctaagcagttagccatcagatacggctctaacgttgaaaatgtattc
agccggattgaaggtctgaaagacgaagcggaaaaacgccagattccggttcacattctg
gctgaagcggcttacagcatcgaagaagaaatggctgcgacacctgccgatttcttcgtc
cgcagaacgggaagactgttcttcgacatcaaatgggtgcaaacgtataaaacggccgtg
attgattacatgagcgaccgattccaatggaatgacgcaacgaaagaaaaacacactgag
tggttaaatacgctgctgcacgacgcggttgttccgctcgaacaataa

DBGET integrated database retrieval system