KEGG   Bacillus sp. BH072: OY17_10880Help
Entry
OY17_10880        CDS       T03582                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacb  Bacillus sp. BH072
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacb01001]
    OY17_10880
Enzymes [BR:bacb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     OY17_10880
Protein kinases [BR:bacb01001]
 Serine/threonine kinases: Other
  Bacterial family
   OY17_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Pkinase_fungal Seadorna_VP7 Haspin_kinase PBP_N
Motif
Other DBs
NCBI-ProteinID: AJE78574
LinkDB All DBs
Position
2176062..2178005
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDNDFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYITAHGPLHPKEALSVMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHLGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYESAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAAPQAETPGETDDKEQQPAKKKKRKWPWVLLSVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLRADPDITDIEDEKIEEELMVKTDPKAGSTVKEGSSVKLYK
SIGKPKTQLIDVKGRQIGDAKKALKEKGFKHVNVKEENDDSEAGTVIDQDPSAGTDMVAS
DDEVNLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKQAHSDDVPKGQVMKQEPS
AGTAVKPGSNVEVTFSLGPEEKPAKTVKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPKDND
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcccattggcggcggc
ggaatggcaaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacaatgattttatcaggcgtttcagaagagaagca
cagtcggcatcaagcctcgatcatccgaatatcgtgagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
accgcacacggaccgcttcatccgaaagaagcgctgtccgttatggagcagatcgtctcg
gccatcgcccatgcccatcaaaaccatatcgtgcatcgggatattaaaccgcacaatata
ttgatagaccatttagggcatatcaaggtgacggatttcggcatcgccacagcgcttacg
tctacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggtcttgcaacgaaaaaatcagatatttacgcgctcggcatcgtgctg
tttgagcttttaacaggtaaaattccttttgacggagaatcagccgtcagcatagcgcta
aagcatctgcaaacagaaacgccttccgccagaaagtggaacccttccattccgcagagc
gtcgaaaacattattttaaaggcaaccgccaaagacccgtttcaccgctatgaaagcgcc
gaggacatggaagcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaaa
ttttccgttcaggatgatgaggaaatgacaaaagccattcccgttattactgacggcgca
aaagccgcgcctcaggcggaaacgccgggggagacggacgataaggaacagcagcccgcc
aaaaagaaaaaacggaaatggccgtgggttttgctgtccgtttgtttcattttcattatg
gcggctgttcttgcggtcaccgtgttcccgtctttatttatgcctaaagatgtaagcgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagccctgcttgaaaagaacgggctc
cgggcggatcctgatataacggacattgaagatgaaaaaatagaagaggaattaatggtc
aaaacggacccaaaagcggggtctaccgttaaagaaggctcttctgtaaaactgtacaaa
agcatcggaaaaccgaaaacccagctgatcgacgtgaaaggacggcagatcggcgacgca
aaaaaagcgctgaaggaaaaaggcttcaaacatgtcaatgtcaaagaagagaacgatgac
agcgaggccggcaccgtaattgatcaggacccgtcagccggcaccgacatggtcgcaagc
gacgatgaagtcaatctaacggtcagcctcggcccggcggacgttacgctgagggactta
aagacttacagcaaagaagcggcttcagggtatcttgaagataacggcctgcagcttgtt
gaaaaacaagcccattcagatgacgtaccaaaaggacaagtcatgaagcaagagccgtca
gccggcactgcggttaagccgggaagtaatgttgaagtgacgttctcgctcggacctgaa
gaaaaaccggcgaaaacggtaaaagaaaaaatcagcattccttacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgatgataaggaccacagcatctctgatacg
tatgactcatttaaaataaaagagccgactgaaaaaacaattgaactgaagattgatcag
ggacagaaggggtattaccaagtgatggtcgatcataaagtcgtcagctacaaaacgatt
gaatacccgaaagataatgactga

DBGET integrated database retrieval system