KEGG   Bacillus sp. BH072: OY17_12695Help
Entry
OY17_12695        CDS       T03582                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00020  Citrate cycle (TCA cycle)
bacb00310  Lysine degradation
bacb00380  Tryptophan metabolism
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
bacb01200  Carbon metabolism
Module
bacb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OY17_12695
  09105 Amino acid metabolism
   00310 Lysine degradation
    OY17_12695
   00380 Tryptophan metabolism
    OY17_12695
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     OY17_12695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N DUF2680
Motif
Other DBs
NCBI-ProteinID: AJE78917
LinkDB All DBs
Position
complement(2651507..2654341)
Genome map
AA seq 944 aa AA seqDB search
MFQNNMKQRMNWEDFYGPNLGYALELYDQYAEDPDSIDPDLKDMFDELGAPPSQIKEASG
TKEQGRVTADLIQKIAAAVKLAEDIRTYGHLNASVNPLRKDPKKSELFPLSEYGLTEEEM
KAIPASVICKDAPANITNGLEAIQHLRNTYKRTISFEFDHVHDFEERAWITKMVESGELF
RKNSPEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKAGTT
NVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGISYGWTGDVKYHLG
ADRQLQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQKGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESDESRSTKYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKRIFAEKLVSEGLISEEQAQNIETAVTKRIEDAYKKVPAKKEDAVREIELPE
PVSNGFPDVDTAIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGEEFVALHHLDDCAASFTVHN
SPLSEGSVLGFEYGYNVYSPETLVMWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFKPVYEQSGLSHAYEKVTRVVLSSGKVSIDISDHF
NKMEGDKDWLHIARIEQLYPFPAKDTKELFAKLPNLQEIVWVQEEPQNMGAWSYISPYLT
EIAPKGVNVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaataatatgaaacaaagaatgaattgggaagatttttacggaccgaacctc
ggctacgcactggagctgtacgaccaatatgctgaagatccagacagcattgatccggat
ctgaaagacatgtttgacgaactcggcgctccgccaagccaaataaaagaggcatcggga
acaaaggaacagggacgcgtcaccgcagatctgattcaaaagatcgcagcagcagttaaa
cttgcagaagatattcgaacctatggccatctgaacgcttccgtcaatccgctcagaaag
gatccgaaaaagagcgagctctttccgttatccgagtacgggcttacagaagaagaaatg
aaagcaatacccgcgtctgtcatctgtaaagacgcacctgccaatataacaaacggctta
gaagccatccagcatttacgcaatacctataaaagaaccatctccttcgagtttgaccat
gtgcatgatttcgaagagcgcgcatggattacaaaaatggtcgaatccggagaactgttc
cggaaaaattcaccggaaaaactgtcagccgttttagaaagactgacggaagtagaagga
tttgaacaatttttacaccggacattcgtcggtcagaagcgtttctcaattgagggatta
gacgcgcttgtgccggttcttgacgacattatcgcccagtctgtgaaagcgggcacaacc
aatgtcaatatcgggatggcgcacagaggccgtttaaatgtgcttgcgcatgtgctcggc
aaaccgtatgagattattttctcagaattccagcacgcgccgaataaagaccttgtgccg
tctgaaggatcgaccggcatcagctacggctggacgggcgatgtaaaatatcacctcggt
gcagacagacagcttcaggatgctgaaaccaaaagcgcgcggattacgcttgcaaataac
ccgagccacttggaattcatcaatccgattgtggaaggaagcacgcgggcggcacaggaa
acaagaacgcaaaaggggtacccggttcaagacgaaacaaaatcgctcgccattttaatt
cacggtgacgcagcgtttccgggagaaggcattgtcgccgagacgctgaacttaagctct
ctgaaaggctatcaggtcggcggggccattcatatcatcgccaataatatgatcggcttt
acaacagaaagcgatgaatcacggtccacgaaatatgccagtgatttggcgaagggctac
gaaatcccgatcgttcacgtcaacgcggatgatccggaagcatgcctgtcagccgttaaa
tttgcggttgaataccggaagcggttcaataaagatttcttaatcgatttaatcggatac
agacggtacggccacaatgaaatggatgagccgtcaacgacacagccgatgctgtatgac
gccgtcagaaaacacccgactgtcaagcggatctttgcggaaaaactcgtaagtgaagga
ctgatcagcgaggaacaagcgcaaaacatcgaaacggcagtgacaaaacgaattgaagac
gcctataaaaaggtgcccgccaaaaaagaagacgccgtacgggaaattgaattgccggaa
ccggtgtccaacggttttccagacgttgacacagccattgattttgatgttctccgcaag
ctgaacggcgaacttatcaactggccggaatcttttaacgtgttcggcaagctgaaaaga
atcctggaaagacgtgcaaaagcgtttgatgatgaccgtaaagttgaatggtcattggct
gaatcacttgcgtttgcttccattttgaaagacggcacgccgatccggctgaccggacag
gattcagagcgcggaacgttcgctcaaagaaaccttgtgctgcatgacagcgaaacagga
gaagaatttgttgccctccatcacttagacgactgcgctgcttcatttacggtgcataac
agcccgctctctgaaggatcggttctcggctttgaatatggatacaacgtgtattcgcct
gaaacgcttgtgatgtgggaggcgcagtacggggactttgccaatgcggctcaagtctat
tttgatcaattcatatctgcaggacgggcaaaatggggacaaaaatcaggcctggtcatg
ctgctgcctcacggttacgaagggcagggccctgaacactccagcggccgcgtcgagcgg
ttcctgcagctggcggcggaaaacaactggacggtggccaacctgacaagtgcggctcag
tatttccacattttaagaagacaagcgaaaatgctgcttcgtgaggaaatccgcccgctt
gtgatcatgacgccgaagagcctgctgcgcaacccgaatacggtatctgaagtgcaggaa
ctgagcgaaagccgattcaagcctgtctatgagcagtccggactttcccatgcttacgaa
aaagtgactcgcgtcgtattatcaagcggaaaagtgtcaattgatatcagcgatcacttc
aacaaaatggaaggcgataaggattggcttcatattgccagaatcgaacagctgtatccg
ttcccggcaaaagatacgaaggagcttttcgccaaactgccgaacctgcaagagatcgtt
tgggttcaggaagagccgcagaacatgggggcatggagttatatcagcccgtatctgacg
gaaatcgcgccaaaaggagtaaatgtccaatacatcggccgaagaagacgatccagtccc
gcagaaggagatccgacagtccacaaaaaagaacaggaacgcattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system