KEGG   Bacillus sp. BH072: OY17_15710Help
Entry
OY17_15710        CDS       T03582                                 

Definition
(GenBank) BofC
  KO
K06318  forespore regulator of the sigma-K checkpoint
Organism
bacb  Bacillus sp. BH072
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    OY17_15710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BofC_C BOFC_N
Motif
Other DBs
NCBI-ProteinID: AJE79495
LinkDB All DBs
Position
complement(3257793..3258302)
Genome map
AA seq 169 aa AA seqDB search
MKRICGARLLFMLILSAAVLICGGKGAYGAEVEHYGPLRVHVQLEKVYLDGDVGIEHTDE
TVLAMEDFWAAYAGWTLVEQKKGFVLFRKHVDDISPLSKINGYIGVTDGGVISTFHGRPG
SLAEPIQSFFQIDIERLESRLQKHLEHGIPYRTKAEFESVIDHIKTYSG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgaatttgcggtgctcgtctattgtttatgcttatcttatcagctgcagtcctg
atttgcggaggaaaaggcgcatacggggcggaggtcgagcattacgggccgcttcgggtg
catgtccagctggaaaaggtctatcttgacggtgatgtcggcattgaacatacggatgaa
accgttttagcgatggaggatttttgggccgcatatgccggctggacgctcgttgagcag
aaaaaaggcttcgtccttttccgtaagcatgttgatgatatttctccgctcagtaagatt
aacggttatatcggcgtcacggacggaggcgtcatctccacttttcacggccgtcccgga
tcgctggccgagccgattcagtctttcttccagattgatatagaaaggctggaaagccga
ttgcaaaagcacttggaacacggcataccgtacagaacaaaagcggagtttgagagcgtg
atcgatcatattaagacttacagcggctga

DBGET integrated database retrieval system