KEGG   Bacillus sp. BH072: OY17_16055Help
Entry
OY17_16055        CDS       T03582                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00020  Citrate cycle (TCA cycle)
bacb00190  Oxidative phosphorylation
bacb00650  Butanoate metabolism
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
bacb01200  Carbon metabolism
Module
bacb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OY17_16055 (sdhB)
   00650 Butanoate metabolism
    OY17_16055 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OY17_16055 (sdhB)
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OY17_16055 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     OY17_16055 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_18 Fer4_2 Fer4 Fer4_16 Fer4_15 Fer4_4 Fer4_13 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AJE79557
LinkDB All DBs
Position
complement(3328317..3329075)
Genome map
AA seq 252 aa AA seqDB search
MSEKKIRFIITRQDTPESAPYDEEFEINYRPNLNVISALMEIRRNPVNAKGEKTTPVAWD
MNCLEEVCGACSMVINGRPRQSCTALIDKLEQPIRLKPMKTFPVVRDLQVDRSRMFDSLK
KVKAWVPIDGTYDLGPGPRMPEKRRQWAYELSKCMTCGVCLEACPNVNSKSKFMGPAPMS
QVRLFNAHPTGAMNKAERLEALMTDGGLGDCGNSQNCVQSCPKGIPLTTSIAALNRDTNL
QAFRNFFGSDRV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaaaagatacggtttatcattacacgtcaggatacgcccgaaagcgcgcca
tacgatgaagaattcgaaatcaattaccgcccgaatctgaacgtgatttctgccctgatg
gaaatccgcagaaatcccgtgaatgcaaaaggagagaaaaccactccggtcgcatgggac
atgaactgtcttgaagaagtatgcggcgcctgctccatggtcatcaacgggagaccgcgc
cagtcatgtacggcgctgattgataagctggaacagccgatccgtctgaagccgatgaaa
acattcccggttgtccgtgaccttcaggttgaccgcagcagaatgtttgattcactgaaa
aaagtgaaagcatgggtgccgattgacggaacttacgatttggggccggggccgagaatg
ccggaaaaacgccgccagtgggcatatgaattgtctaaatgcatgacatgcggcgtctgc
ctcgaagcctgcccgaacgtcaacagcaagtcgaaattcatggggcctgccccgatgtcg
caagtgcgtctgtttaacgcccatccgacgggcgcgatgaacaaagcagaacgtttagaa
gcgttaatgacagacggcggccttggagattgcgggaattcacaaaactgtgtgcaatcc
tgcccgaaaggcattccgcttacgacttcaatcgccgctttgaacagagataccaattta
caagcattccgtaatttcttcggaagcgacagagtataa

DBGET integrated database retrieval system