KEGG   Bacillus sp. BH072: OY17_16060Help
Entry
OY17_16060        CDS       T03582                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00020  Citrate cycle (TCA cycle)
bacb00190  Oxidative phosphorylation
bacb00650  Butanoate metabolism
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
bacb01200  Carbon metabolism
Module
bacb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OY17_16060 (sdhA)
   00650 Butanoate metabolism
    OY17_16060 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OY17_16060 (sdhA)
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OY17_16060 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     OY17_16060 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored Not3 DUF844 DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJE79558
LinkDB All DBs
Position
complement(3329078..3330838)
Genome map
AA seq 586 aa AA seqDB search
MSQSSIIVVGGGLAGLMATIKAAESGTAVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPFEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDERTCRGIVAQNLT
NMQIESFRSDAVIMATGGPGIVFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTSIRGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAVKYVSGLETSAEDL
SSSLFDSYVKKEEEKWADIMKMDGDENAYVLHRELGEWMTANVTVVRHNDKLLKTDDKIQ
ELMERFKKININDTTKWSNQGAMFTRQFSNMLQLARVITLGAYNRNESRGAHYKPDFPER
NDDEWLKTTMAKHAGPFEAPEFEYQDVDVSLIAPRKRDYSKKKVAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcattatcgtagtcggcgggggtcttgccggcctcatggcgacaatt
aaagcagcggaatcaggcacggccgttaaattgttttccatcgttccggtcaaacgctct
cactcggtctgcgcgcagggcgggataaacggagctgtcaacacaaaaggggaaggagac
tctccgtttgagcattttgatgacacggtatacggaggcgactttttggcaaaccagcct
cctgtaaaagcgatgtgtgaagcggcgccgtccattatccacttattggaccgcatgggg
gttatgtttaacagaacgccggaagggcttttggacttccgccgtttcgggggtacacag
catcacagaaccgcatacgcgggagcgacgacgggtcagcagcttctttacgcactggac
gagcaggtgcgcagatatgaagtggcgggtctcgtcacaaaatacgaaggctgggaattc
ctcggcgccgttcttgacgatgagcgcacgtgccgcggtatcgtagcccaaaatctgacc
aatatgcaaatcgagtcattccgttctgacgccgttattatggcgacgggaggacccgga
atcgtattcggaaaatcaacaaacagcatgatcaacacgggatctgccgcatcaatcgtt
tatcagcagggcgcttattatgcaaacggcgaatttatccaaattcacccgacagcaatc
ccgggggacgataaactgcgtctgatgagtgaatcggcacgcggcgagggcggaagagtc
tggacgtacaaagacggaaaaccttggtacttccttgaggaaaaatatccggcttacgga
aacctcgtgccgcgggatattgcgacacgtgaaatctttgacgtgtgtgtgaatcagaaa
ctcggcatcaacggagaaaacatggtgtatctcgatctgtcgcacaaagatccgaaagag
cttgacgttaagcttggcggcattatcgaaatctatgaaaaattcatgggcgatgacccg
cgcaagcttccgatgaaaattttccctgccgttcactattcaatgggcggactgtgggtt
gattatgatcagatgacaagcatccgcggactgttcgcagcgggtgaatgtgattattca
atgcacggaggaaaccgtttaggggcgaactctctgctttccgccatctacggaggaatg
gtggccggaccgaatgcggtgaaatatgtttccggacttgaaacatcagcggaagacctg
tcttcttcattatttgattcctatgtgaaaaaagaagaagaaaaatgggccgatattatg
aagatggacggcgacgaaaatgcctacgtgcttcaccgtgagctcggagagtggatgacg
gccaacgtcacggtggtccgccacaacgacaagcttttgaaaacggatgacaagatccaa
gagctgatggaacgctttaagaaaatcaatatcaacgatacgacaaaatggagcaaccaa
ggggcgatgttcacccgccagttctccaatatgcttcagcttgccagagtcatcacgctc
ggcgcatataaccgaaatgaaagccggggagcgcactataaaccggatttccctgaaaga
aatgacgatgagtggctcaaaacgacgatggctaaacatgccggtccgtttgaagctccg
gaatttgaatatcaggatgtcgatgtatcactgattgcgccccgtaaacgcgactactcg
aagaagaaggtggcgaaataa

DBGET integrated database retrieval system