KEGG   Bacillus sp. BH072: OY17_16435Help
Entry
OY17_16435        CDS       T03582                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00010  Glycolysis / Gluconeogenesis
bacb00030  Pentose phosphate pathway
bacb00051  Fructose and mannose metabolism
bacb00052  Galactose metabolism
bacb00680  Methane metabolism
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
bacb01200  Carbon metabolism
bacb01230  Biosynthesis of amino acids
bacb03018  RNA degradation
Module
bacb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bacb_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OY17_16435
   00030 Pentose phosphate pathway
    OY17_16435
   00051 Fructose and mannose metabolism
    OY17_16435
   00052 Galactose metabolism
    OY17_16435
  09102 Energy metabolism
   00680 Methane metabolism
    OY17_16435
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    OY17_16435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacb01009]
    OY17_16435
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bacb03019]
    OY17_16435
Enzymes [BR:bacb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     OY17_16435
Protein phosphatases and associated proteins [BR:bacb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     OY17_16435
Messenger RNA biogenesis [BR:bacb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     OY17_16435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AJE79628
LinkDB All DBs
Position
complement(3412044..3413003)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMQEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggcggggattccccgggtatgaacgctgcggtg
cgcgcggttgtgcggaaagctatctaccacgacgtcgaagtgtacggaatttataacggt
tattcaggattaatcagcggaaaaatagagaaactggagcttggttcggtcggtgacatc
atccaccgcggcggaacaaagctgtacacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcattgaaggtcttgtcgtcatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgtg
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgctaaataccgtaattgatgcgattgataaaatccgtgacaccgctacgtctcat
gagcgtacatacgttattgaagtgatggggcgccatgcgggcgacattgctttatgggca
ggtcttgcaggcggagcggaatcaattttaattcctgaagcggactacgatatgcaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system