KEGG   Bacillus sp. BH072: OY17_17775Help
Entry
OY17_17775        CDS       T03582                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K16216  benzil reductase ((S)-benzoin forming) [EC:1.1.1.320]
Organism
bacb  Bacillus sp. BH072
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OY17_17775
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.320  benzil reductase [(S)-benzoin forming]
     OY17_17775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AJE79854
LinkDB All DBs
Position
complement(3653829..3654560)
Genome map
AA seq 243 aa AA seqDB search
MQFFLITGASKGLGRALTEQALQEGAEVAALSRTISGEKREGLTEYSVDLTDLADTGRQM
KAILDQAEEKGYSAVTLINNAGMVEPIKRAKEASAEELNRHYTLNLTAPVLLSQMFTKRF
EAFSGSKTIVNITSGAAKNPYKGWSAYCSSKAGLDMFTRTFGFEQEDEELPVRMISFSPG
VMDTDMQAVIRSSSKEDFHDIERFRNLKETKNLRSPEYIAGVIHSLIAGEPENGRIYDIK
EFL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcagttttttcttataacaggcgcgtcaaaaggcttgggccgggcgcttacggaacag
gcgcttcaagaaggagccgaagtcgccgcgctttcaagaacgataagcggggaaaagcgc
gagggactgacagaatacagtgttgatttaaccgatctggcagataccgggcggcagatg
aaggcgattcttgatcaagcagaggagaagggatactccgccgtcacactgatcaacaat
gccggaatggtggaaccgatcaagcgggcgaaagaggcttccgccgaagaattgaaccgc
cattacacccttaatctgacggcgcccgttttgctcagccaaatgttcacaaagcgtttc
gaagcgttcagcggcagcaaaacaattgtcaacatcacatcgggcgcggcgaaaaatcct
tataaaggctggagcgcgtattgcagctcaaaagcggggcttgatatgtttacgagaaca
ttcgggtttgaacaggaggatgaagagctgccggtccgcatgatctcattctcgccggga
gtgatggatacagacatgcaggctgtcatccgttcttcgtcaaaagaagattttcatgac
atcgaacggttccgcaatctgaaagaaacgaaaaacctcagaagtcctgaatacatcgcc
ggcgtcattcactcactgatcgcgggcgagccggaaaacggacggatatacgatatcaaa
gaatttttgtag

DBGET integrated database retrieval system