KEGG   Bacteroidales bacterium CF: BRDCF_p1125Help
Entry
BRDCF_p1125       CDS       T02861                                 

Definition
(GenBank) Alpha-Glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bacc  Bacteroidales bacterium CF
Pathway
bacc00500  Starch and sucrose metabolism
bacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRDCF_p1125
Enzymes [BR:bacc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BRDCF_p1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AGY53752
UniProt: U5Q598
LinkDB All DBs
Position
complement(1340944..1343151)
Genome map
AA seq 735 aa AA seqDB search
MCNLLKLNLIGGLLTLISIAPLKAQNRNLQILKSPNGETEMTFTLTNEGAPLYSLAFKGK
TVIKPSKLGIELAPEVVHRDFDDFAPAIAPNNEAVNIKSNLYSGFVIKDIQTASIDQVWH
PVWGESKDIRNQYNELIVSLYQASNDRYIKLCFRLFNDGLGFRYEFPQQKNLVYFVIKEE
HSQFAMTGDHIAYWIAGDYDTQEYDYTTSRLSEIRSLMPYAITPNASQTPFSPTGVQTAL
MMKTDDGLYINLHEAALIDYSCMSLNLDDKNYIFESWLTPDAQGNKGHLQAPCKSPWRTI
IVSDDARKILSSNITLNLNEPCKIEDVSWIKPVKYVGVWWEMITGKSSWAYTDDLPSVQL
GVTDYSKVKPNGKHGANTAHVKEYLEFAAEHGFDAVLVEGWNVGWEDWFGNSKDYVFDFL
TPYPDFDVEELRQYAASKGVKIIMHHETSSSAINYERHMDQAYKFMKDNDYDAVKSGYVG
NIIPRGEHHFGQWMNNHYLYAIKKAADYKIMVNAHEAVRPTGLCRTYPNMIGNESARGTE
YQAFGGSKPNHVTILPFTRLIGGPMDYTPGIFEMDIQKINPGNTSHANCTIANQLALYVV
MSSPLQMAADLPENYNRFLDAFQFIKDVALDWDESIYLEAEPGEYITVARRAKGSEKWFV
GNVCGENGFESAISLNFLTPGKKYTAKIYSDAKDADYKKNPQAYEIREIVVTNKTKLTQK
SAPGGGYAISIVPKD
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaacctgcttaaattaaatctaataggaggtcttctgactttaatctctattgcc
ccgcttaaagcacaaaaccgcaatttgcagattcttaaatcccctaacggagagactgaa
atgacatttactttgactaacgagggagcaccactctactctctggcattcaaaggtaaa
actgttatcaaaccaagtaaactggggatagaactggcaccggaagttgttcatcgtgac
ttcgatgattttgctccggcaatcgctccaaacaatgaagcagtcaatattaaatcaaat
ctctatagcgggtttgttataaaagatattcaaactgcctctattgaccaggtatggcac
cctgtatggggagagtcgaaagatatccgcaatcagtataatgaattgatagttagtttg
tatcaggcttccaacgacaggtatataaaactctgtttccgcctttttaacgacggattg
ggttttcgatacgaattcccgcaacagaaaaatcttgtctattttgttattaaagaggaa
cacagccagtttgccatgacaggagatcatatagcatactggattgcaggtgattatgac
acacaggaatacgattatacaacttcccgtttgtcagagatacgttcactgatgccatat
gcaataactccgaatgcatcacagactccattttctcccactggggtgcagacagctctt
atgatgaagacagatgacggtttatatataaatctgcacgaggctgccttgattgactac
tcgtgtatgagtctcaaccttgatgataagaattatatatttgaatcctggcttactccc
gatgctcagggaaataaaggacacctgcaggctccttgtaaaagtccatggagaacaatt
attgtaagtgatgatgcgagaaaaatacttagttcgaatatcactctcaatctcaatgag
ccttgtaagatagaggatgtatcatggataaaacctgtcaagtacgtaggtgtatggtgg
gagatgataaccggtaaaagttcctgggcatatactgatgacctcccaagtgtacaactt
ggggttactgattattcaaaggtgaagcctaatggaaaacatggggcaaacacagcccat
gttaaagagtatttagagtttgctgccgaacatggttttgatgcggttctggttgagggg
tggaatgtaggatgggaagactggtttggaaattcaaaagattatgtttttgacttcctg
acaccttacccggattttgatgttgaggagttaagacaatacgcagcctcaaaaggcgtt
aaaattattatgcatcatgagacatcctcttctgcaataaattacgagaggcatatggat
caagcatacaaatttatgaaagataatgattatgatgccgttaaaagcggttatgtaggg
aatataataccaaggggagagcatcatttcggccaatggatgaataatcactatctctat
gctatcaagaaagcagctgattacaaaatcatggttaatgctcatgaagctgtccgtccg
acagggttatgcaggacatatccaaacatgattggaaatgaatctgccagaggcacagaa
tatcaggcatttggaggtagtaagcccaatcatgttaccattctcccttttacgcgtctt
atcggagggcctatggactatactcctggtatatttgagatggatattcaaaagattaac
ccgggaaatacttcacacgcaaattgtactattgccaatcaactcgccctttatgtcgtg
atgtcgtctccacttcaaatggcggctgatctgccggagaattacaacaggttcttggat
gcatttcagtttatcaaagatgttgccttggattgggatgagagtatttatcttgaagca
gagcccggagagtatattactgttgccagaagggcaaaagggagcgaaaagtggtttgtc
ggtaatgtatgcggggaaaatgggtttgagtctgccatctcactaaacttcttaactccg
gggaaaaaatatacagcaaaaatttattcagatgccaaagatgccgattacaagaaaaat
ccacaggcctatgaaataagagagattgttgttacaaacaagacgaaattgactcagaaa
tccgcaccgggtgggggctacgcaataagtatagtaccaaaggattag

DBGET integrated database retrieval system