KEGG   Bacteroidales bacterium CF: BRDCF_p2024Help
Entry
BRDCF_p2024       CDS       T02861                                 

Gene name
aroC
Definition
(GenBank) Chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
bacc  Bacteroidales bacterium CF
Pathway
bacc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bacc01100  Metabolic pathways
bacc01110  Biosynthesis of secondary metabolites
bacc01130  Biosynthesis of antibiotics
bacc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bacc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRDCF_p2024 (aroC)
Enzymes [BR:bacc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     BRDCF_p2024 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AGY54651
UniProt: U5Q7Z6
LinkDB All DBs
Position
2332405..2333367
Genome map
AA seq 320 aa AA seqDB search
MNNFGRNFRISIFGESHGPKIGLVIDGTPSGIPLSGEDFVSDLSRRRSGKPGTTPRVEGD
LPEIVSGVYNGYTTGAPICILFSNDNTRSADYIELADKPRPGHADFVSMLKRGGYVDPRG
GGHHSGRITLTMVTAGVIAKKILGNISIEAKLIRVGGKESWDDLLEKTREEGDSLGGIVE
CTAKNMPVGLGEPFFDSLESLLSHAIFSIPGIRGIEFGDGFAASAMKGSDHNDPIIDSNG
KTSKNGAGGINGGISNGNDLLFRVAVKPTSSISKSQQTFNFSTGKVEELQIAGRHDTCFA
LRVPVVVEAATAIVLADLIL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttcggcaggaacttcagaatctccatcttcggagagtcacacgggccaaag
ataggattggttatagatggtactccttcaggaatacctctgtccggagaggattttgta
tctgatctttcacggaggagaagcgggaaaccggggacaacgccaagagtggagggagat
ctgccggaaatcgtcagtggcgtttataacggttatacaaccggggcacctatatgcata
ctattcagtaatgacaacaccagatctgcagattatattgaactggcagacaaaccaaga
ccgggccacgccgattttgtatcaatgctcaaaagagggggatatgttgatccgcgagga
ggtggtcaccattctggcagaataaccttgactatggttactgccggtgtaattgcaaaa
aagatactggggaacatctctattgaagcgaagctaatccgtgtcggcgggaaggagagt
tgggacgatttgcttgaaaagacaagggaagagggtgattctctgggaggaattgtcgaa
tgtacagccaaaaatatgccggtcggcctcggagagccatttttcgactctttggagtca
cttctctcgcatgcaatcttctccatccccggaatccgcgggattgaatttggcgacgga
tttgccgcctctgcgatgaaggggtccgatcacaatgacccgattatcgacagcaatgga
aaaacctccaaaaatggagcggggggcataaacggtggcatatcgaacggaaacgatctc
ttgttcagagttgccgtaaaaccaacatcaagtatttcaaaaagtcaacaaacatttaac
ttctcgaccggcaaggtggaggagcttcaaatagcaggcagacacgacacctgtttcgcc
ctaagggtgccggttgtcgttgaggctgccacagcaatagtcctggccgatcttatactt
taa

DBGET integrated database retrieval system