KEGG   Bacteroidales bacterium CF: BRDCF_p532Help
Entry
BRDCF_p532        CDS       T02861                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bacc  Bacteroidales bacterium CF
Pathway
bacc00240  Pyrimidine metabolism
bacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BRDCF_p532 (tdk)
Enzymes [BR:bacc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BRDCF_p532 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Ribosomal_L37e
Motif
Other DBs
NCBI-ProteinID: AGY53159
UniProt: U5Q762
LinkDB All DBs
Position
complement(641262..641831)
Genome map
AA seq 189 aa AA seqDB search
MFLESAKKSGWIEIICGSMFSGKTEELIRRLKRAKFANLKVEIFKPKVDTRYSEEDVVSH
DSNAIRSTAVDSPMSILLYASDVDVVGIDEAQFFDDSIVEVCQQLAANGVRVIVAGLDMD
YLGKPFGSMPALMAVAEYVTKVHAICVRCGDLAHHSHRLTKSDKLVMLGEKDTYEPICRH
CFNGLRKTD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagaaagtgcaaaaaaatcagggtggatagagataatctgcgggtcaatgttt
tcgggtaaaacagaagaattaataagacgattgaagagagcaaagtttgcgaacctcaag
gttgagattttcaaaccgaaagttgacacgcggtattcggaagaagatgtcgtgtcacat
gactccaatgcaatccggtctacagccgtagactcacctatgagcattctcctttatgca
tcagatgtggatgttgttggaatagatgaagcccagttttttgacgactctattgttgaa
gtttgccagcaacttgcagctaacggcgttcgtgtaattgttgcgggacttgatatggat
tatctggggaaacctttcggatcaatgccggctctgatggccgttgcagaatatgtcacc
aaggttcatgctatctgcgtaagatgtggcgatcttgcacatcactcacatagattaaca
aaaagcgacaaactggtcatgcttggtgaaaaagacacctacgagccaatttgtcgccat
tgtttcaatggtcttagaaagaccgattaa

DBGET integrated database retrieval system