KEGG   Bacteroidales bacterium CF: BRDCF_p582Help
Entry
BRDCF_p582        CDS       T02861                                 

Definition
(GenBank) Putative alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
bacc  Bacteroidales bacterium CF
Pathway
bacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRDCF_p582
Enzymes [BR:bacc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BRDCF_p582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AGY53209
UniProt: U5Q7A4
LinkDB All DBs
Position
692045..693256
Genome map
AA seq 403 aa AA seqDB search
MEKSICLYFQVHQPDRLRQYRFFDIGKESYYYDDFANRTILRRVSDLCYLPANQLMLDLI
RECKGAFKIAFSISGSLIDQLEKHAPEVIDSFRELADTGCVEFLAETYYHTLASLISPDE
FKAQVTMHSKRIEALFGKRPVVFRNTEMIYSDEIGAMVADMKFNAMLTEGARHILGWKSP
NYVYTNAINPRLKLLLRNFNLSDDIAFRFSNRGWSNWPLTSDKYVTWISNALSKDEVVNL
FMDYETFGEHQHASTGIFQFMRYLPATVLSQTSFKFCTPSEVCKRHQPIAPLNVPFPISW
ADEERDTTAWLGNELQNEAFSKLYSVEKRIHKLKNPQLTADFRKLQESDHFYYMCTKFFS
DGVVHGYFNPYETPYEAFINYMNILSDFLIRVERINGSRNKRD
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagtatatgtttgtattttcaggttcatcaaccggacaggctcagacaatac
aggttttttgatattgggaaagagtcttattactatgatgattttgccaacagaacaatt
ctcaggagggtttccgatctctgttacctgccggcaaaccagcttatgctggatcttatc
agggagtgtaagggagcttttaaaatagccttttccatatccggttcgcttattgaccaa
ctggaaaaacatgcgccggaggtaattgacagcttcagagagcttgccgataccggttgt
gtggaatttctggctgagacatattatcacactctggcatccctgatttcaccggatgaa
ttcaaggctcaggtgacaatgcactcaaagcgtatagaggctttgtttggaaagagacct
gttgttttcagaaacacggagatgatctattccgacgagataggggccatggttgcagat
atgaaattcaatgcaatgctcacagagggagcaaggcatattctcggatggaaaagcccc
aattatgtatatacgaacgcaataaacccaaggctgaagctcttgttgagaaacttcaac
ctcagtgatgacattgctttcagattctcaaacaggggttggtcaaactggccgctcacc
tcagacaaatatgtcacatggatatcaaacgccctctcaaaagatgaggttgtcaatctt
ttcatggattacgagacattcggagagcatcagcacgcatctaccgggatcttccagttt
atgaggtatcttcctgcgacagtattgtcacagacaagtttcaaattctgcacaccttcg
gaggtgtgcaagagacatcagccgatcgctcctctcaatgtgcccttcccgatctcttgg
gcagatgaggagagagatactaccgcatggctgggtaacgagttgcagaatgaggctttc
agcaagctatactccgtagagaaacgcattcacaagttgaaaaatccacaactgactgca
gacttcagaaagttgcaggagagcgaccatttctactacatgtgtactaaatttttctca
gatggtgtggtacacggttatttcaacccttatgagaccccttatgaggcatttatcaat
tatatgaacatcctgagcgactttctcatacgggtagagagaattaatggttccaggaat
aaacgagattaa

DBGET integrated database retrieval system