KEGG   Bacteroidales bacterium CF: BRDCF_p979Help
Entry
BRDCF_p979        CDS       T02861                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bacc  Bacteroidales bacterium CF
Pathway
bacc00564  Glycerophospholipid metabolism
bacc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bacc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRDCF_p979 (glpD)
Enzymes [BR:bacc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BRDCF_p979 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 HI0933_like FAD_oxidored 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AGY53606
UniProt: U5Q513
LinkDB All DBs
Position
1167203..1168768
Genome map
AA seq 521 aa AA seqDB search
MKREELIKKVSDESKVWDMVVIGGGATGLGVALDAALRGFSVALFEMEDFAKCTSSRSTK
LVHGGVRYLQKGDVQLVREALHERGRLKQNAPHLVKDQSFVIPNYTHFDNLLYTCGLTFY
DMLSWGLSLGRSLYISKKRVAKCLPTIVTEGLKGGVIYHDGQFDDSRLAINLAQSIVEEG
GCPINKMKVEGIIHNASGKVAGVKIKDITTDSEYSVKAKSVINAAGVFVDDIILMDVPST
HRMVKPSQGIHLVFDKSFLNTDYAIMIPKTSDGRVLFAVPWHDKVVVGTTDIVREHAETE
PKPLEEEIDFIMSTASLYMAKKPTRSDILSVFAGQRPLAAPKKEGKSTKEISRSHKIFVS
DNNLITITGGKWTTYRKMAEDTVDKAISMSLLPAKKCTTMNYRIHGYRPKPDLTNHLYVY
GSDMPAIEKLIKSGNGMNEKIHPKYDYTVAEVVWAVREEMALTLDDVLGRRARLLFIDAR
AAIEAAPKVAQVMSKELGKDQAWIDSQTESFIKLANNYIVK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgaagagttaattaaaaaggtatccgacgaatcaaaggtatgggatatggtc
gtgataggtggaggagctacaggcctcggtgtcgcacttgatgcagcattacggggattc
agtgtggcattgtttgaaatggaagattttgccaagtgtacttcaagcagaagtaccaag
cttgtacacggtggtgtgcgttatcttcaaaaaggagacgtgcagcttgtaagggaagct
ttacatgaaaggggcagattgaagcaaaatgctcctcacttagtaaaagaccaatcattc
gttattccgaactacactcattttgacaatctactttatacctgcggcctgactttttat
gatatgctgtcatggggtctgagtctgggaagatcattatacatatcaaagaaaagagtt
gccaagtgtcttcctacaatagttactgaaggtctgaagggtggtgttatctatcatgat
ggtcagtttgacgattcacgtcttgccattaaccttgcacaatcaatagttgaagaaggc
ggatgtccgataaataaaatgaaggtagagggcattattcacaatgcatcaggaaaagtt
gcaggagtaaaaattaaggatatcacaacagattcggaatattcggtaaaggcaaaatcg
gttatcaatgctgccggtgtattcgtagatgacattattctcatggatgtgccttctaca
cacagaatggtaaaaccaagccagggaattcaccttgtttttgacaaatcattcttgaac
acagactatgcaatcatgatccctaaaacctccgatggccgtgtcctttttgccgttcca
tggcatgacaaggttgttgtaggtacaacagatatagtaagagagcatgcagagacagaa
ccaaaacctctagaggaggagattgattttatcatgagtacagcatcactttatatggca
aagaaacctacaagaagtgatattctttcagtctttgcaggtcaacgtcctcttgcagca
ccaaagaaagagggtaagagtacaaaagagatttcaagaagtcacaaaatatttgtctca
gataataatctgattacaatcacaggcggaaagtggacaacatacagaaagatggctgag
gatacagttgacaaggctatatccatgagtttgcttcctgcaaagaaatgtactacaatg
aattatagaatccacggttacagaccaaaaccggatcttacaaaccatctatatgtatat
ggatctgatatgcctgcaatcgagaagcttatcaaatccggcaatggtatgaatgagaag
atccatccaaaatatgattacactgtagctgaagttgtgtgggctgtaagagaggagatg
gccctgacacttgatgacgtccttggccgcagggcacgtttgctctttattgatgcaaga
gctgctattgaagctgcacctaaagtagcgcaggtgatgtcaaaggaactaggtaaagat
caggcatggattgactcgcagactgagagctttattaaattggcaaataactatatagtt
aaataa

DBGET integrated database retrieval system