KEGG   Bacillus sp. 1NLA3E: B1NLA3E_00335Help
Entry
B1NLA3E_00335     CDS       T02643                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
baci  Bacillus sp. 1NLA3E
Brite
Chaperones and folding catalysts [BR:baci03110]
 Heat shock proteins
  HSP33
   B1NLA3E_00335 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 PriA_3primeBD
Motif
Other DBs
NCBI-ProteinID: AGK51851
UniProt: N0ATT7
LinkDB All DBs
Position
80978..81856
Genome map
AA seq 292 aa AA seqDB search
MSDYLVKGLAFDGQVRAYAARTTQTVEEAQRRHHTWPIASAALGRTMTAGVIMGAMLKGD
QKLTIKIEGGGPIGPILVDSNAKGEVRGYVTNPHIHFEQNAQGKLNVGKAVGNTGTLTVV
KDIGLRDFFSGQVPIVSGELGEDFSYYFATSEQVPSSVGVGVLVNPDNSILAAGGFIIQL
MPDTQEETIEKIEQKLKEIPAVSSLIQRGLNPEELLEEILGKGNVHFLETVPVSFSCNCS
KGRFASAIIGLGKAEIKDMIEEDGQAEVHCHFCNEKYLFSKQELEELGKEAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattatttagtaaagggcttagcatttgatggccaggttagggcatatgccgca
agaacaacgcaaacagttgaagaagcacaaaggcgccaccatacatggcctattgcttca
gcagccttaggacggaccatgacagcaggtgttattatgggcgctatgttaaagggagat
caaaagctaacaattaagattgaaggtggaggtcctattgggccaatattagtagatagt
aatgcaaaaggtgaggttagaggatatgttaccaatccacatatccactttgaacaaaat
gcccaaggaaagcttaatgttggtaaagctgttgggaacactggaacgttaactgttgtt
aaggatatcggtctgagagacttttttagcggtcaagtcccgattgtgtcaggagaattg
ggagaagacttttcctattattttgccacatcagaacaagttccatcgtcagttggtgtg
ggtgttctagttaatccggataattcaattttggctgcaggtggatttattattcaactg
atgcctgatacacaagaagaaacgattgaaaagatagaacagaagcttaaagaaattcct
gccgtatcaagtttgattcagaggggactaaatccggaggagctgttagaagaaattcta
ggtaaaggaaatgttcattttcttgaaaccgtgcctgtttctttttcatgtaattgttcg
aagggccgctttgccagcgcgattattggtttaggaaaagcggagataaaggatatgatt
gaggaagatggacaagcagaggtccattgtcatttctgcaatgaaaaatatcttttttca
aagcaagagttagaggaattaggtaaagaggctaaataa

DBGET integrated database retrieval system