KEGG   Bacillus sp. 1NLA3E: B1NLA3E_00525Help
Entry
B1NLA3E_00525     CDS       T02643                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
baci  Bacillus sp. 1NLA3E
Brite
KEGG Orthology (KO) [BR:baci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:baci03012]
    B1NLA3E_00525
   03029 Mitochondrial biogenesis [BR:baci03029]
    B1NLA3E_00525
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baci04147]
    B1NLA3E_00525
Translation factors [BR:baci03012]
 Eukaryotic Type
  Elongation factors
   B1NLA3E_00525
 Prokaryotic Type
   B1NLA3E_00525
Mitochondrial biogenesis [BR:baci03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B1NLA3E_00525
Exosome [BR:baci04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B1NLA3E_00525
  Exosomal proteins of breast cancer cells
   B1NLA3E_00525
  Exosomal proteins of colorectal cancer cells
   B1NLA3E_00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGK51889
UniProt: N0AKG9
LinkDB All DBs
Position
131589..132776
Genome map
AA seq 395 aa AA seqDB search
MAKAKFDRSKPHVNIGTIGHVDHGKTTLTAAITSVLAKEGKAEARAYDQIDGAPEERERG
ITISTAHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPYLVVFMNKCDMVDDEELLELVEMEIRDLLSEYEFPGDDIPVIKGSALKALE
GEAEWEEKIHELMNAVDEYIPTPTRDTDKPFMMPVEDVFSITGRGTVATGRVERGVVKVG
DVVQIIGFTEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREEIERGQVLAKPGSI
TPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTSDITGIVILPEGVEMVMPGDNIEM
IVELIAPIAIEEGTRFSIREGGRTVGSGVVTTITE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaaattcgaccgttcaaagccccatgttaatattggtacaatcggacac
gttgaccatggtaaaacaactttaacagctgctatcacttctgttctagcaaaagaaggt
aaagctgaagcacgcgcatacgatcaaatcgatggtgctcctgaagagcgtgagcgtggt
atcacaatctcaactgcacacgtagagtacgaaactgaagcacgtcactatgcacacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgcagcacaaatggat
ggcggtatcctagttgtttctgcagctgacggtccaatgccacaaactcgtgagcacatt
ctactttctcgtaacgttggtgttccttaccttgttgtattcatgaacaaatgtgacatg
gtagatgatgaagagttactagaattagttgaaatggaaattcgtgatcttctttctgaa
tatgaattccctggtgatgatattccagttatcaagggttctgcattaaaagctcttgaa
ggcgaagctgaatgggaagaaaaaattcatgaacttatgaatgctgttgatgagtatatc
ccaacaccaactcgtgacactgataagcctttcatgatgcctgttgaggatgtattctca
atcacaggtcgtggaactgttgcaactggacgtgttgagcgtggagtagttaaagttgga
gacgttgttcaaatcatcggtttcacagaagagcctaagagcactactgtaacaggtgtt
gaaatgttccgtaagcttcttgattatgcagaagctggcgacaacattggtgcccttctt
cgtggggttgctcgtgaagaaatcgaacgtggccaagtattagcaaagccaggttcaatt
actccacatacaaaatttaaagctgaagtttatgtattgtctaaagaagaaggtggacgt
catactccattcttcacaaactaccgtccacaattctatttccgtacttctgatattact
ggaatcgtaattcttcctgaaggcgttgaaatggtaatgcctggtgataatatcgaaatg
atcgttgaacttattgctcctatcgcgattgaagagggaactagattctctatccgtgaa
ggcggacgtactgttggatcaggtgttgtaacaacaatcactgagtaa

DBGET integrated database retrieval system