KEGG   Bacillus sp. 1NLA3E: B1NLA3E_00935Help
Entry
B1NLA3E_00935     CDS       T02643                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00473  D-Alanine metabolism
baci01100  Metabolic pathways
baci01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B1NLA3E_00935 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    B1NLA3E_00935 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:baci01011]
    B1NLA3E_00935 (alr)
Enzymes [BR:baci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B1NLA3E_00935 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:baci01011]
 Precursor biosynthesis
  Racemase
   B1NLA3E_00935 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C SH3_5
Motif
Other DBs
NCBI-ProteinID: AGK51971
UniProt: N0AU74
LinkDB All DBs
Position
209614..210801
Genome map
AA seq 395 aa AA seqDB search
MNGVKEVDGLDEQGYFYRDTWVEIDLDRVSENIKGLRERLPDNVGIMAVVKANAYGHGDV
QISNTAIVAGASYLAVAFLDEALSLRKKGIKAPILVLGASRPQDVSLAVDHHVTLTVFRV
DWLEEAKAYLTGDQVLKLHVKIDSGMGRIGIRDKQELQLVENRIIEDNRMELEGVFTHFA
TADEINTEYFMQQFERFKQMVDWFRIRPKYIHCSNSAASLRFKDANFNAVRMGISMYGLT
PSIEMETEIPFPLKEAFSLHSRLVHVKRLQKGEKVSYGATYEAEGEEWIGTIPIGYADGW
IRKLQGQEVLVNGIRVPIVGRICMDQCMIKLPYEMQVGTKVTLIGEQDGDMISVNEIAKR
AETINYEIPCIISNRVPRIYKQQGEVVDIYNPIAE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggttaaggaagtggacggattggatgagcaaggatatttttaccgagatacc
tgggtggaaatcgatttagaccgggtctcggaaaacataaagggcttaagagagagatta
ccagataatgtggggattatggccgttgttaaggcaaatgcttatgggcatggagatgtt
caaatttccaacaccgctattgttgcaggtgcaagctatttggcggtagcctttttagat
gaagctctttccttaagaaaaaaagggattaaggcaccaatccttgtgttgggggcaagt
cgaccacaggatgtgagtcttgcggtagatcatcacgtaaccctaaccgtgtttcgagta
gattggcttgaagaagcgaaggcctatttaacaggagatcaagtcttaaagcttcatgta
aaaattgattcaggaatgggacggattggaattcgggataaacaggaacttcaattagtg
gaaaataggattattgaagataaccgaatggagctagaaggggttttcacccattttgcc
actgctgacgaaatcaataccgaatattttatgcaacagtttgaacgctttaaacaaatg
gttgattggtttcgaattcgtccaaaatatattcattgcagtaatagcgctgcctcattg
agatttaaggatgcaaactttaatgcagttcgaatgggtatctcaatgtatggcttgacg
ccatcaatagaaatggaaacggagattccgtttccattaaaagaagccttttctttacat
tcgcgcctagtccatgtaaaaaggctccaaaagggagaaaaggtcagctacggtgccacc
tatgaagcggaaggtgaagaatggattggaaccattccaattggctatgcagacggatgg
attcgtaaactgcaagggcaagaagttttagtgaatggaattagagtgccgatcgtcggg
cgtatttgtatggatcagtgtatgattaaacttccgtatgagatgcaggttggaacaaag
gttaccttgataggggagcaagatggagatatgatctctgtgaatgagatagctaagcgg
gcggaaacgattaattatgaaattccatgtatcatttcaaaccgtgttccccgtatttat
aagcagcaaggtgaggttgttgatatatataatccaattgcggagtaa

DBGET integrated database retrieval system