KEGG   Bacillus sp. 1NLA3E: B1NLA3E_01405Help
Entry
B1NLA3E_01405     CDS       T02643                                 

Definition
(GenBank) putative ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00010  Glycolysis / Gluconeogenesis
baci00030  Pentose phosphate pathway
baci00051  Fructose and mannose metabolism
baci00052  Galactose metabolism
baci00680  Methane metabolism
baci01100  Metabolic pathways
baci01110  Biosynthesis of secondary metabolites
baci01120  Microbial metabolism in diverse environments
baci01130  Biosynthesis of antibiotics
baci01200  Carbon metabolism
baci01230  Biosynthesis of amino acids
baci03018  RNA degradation
Module
baci_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B1NLA3E_01405
   00030 Pentose phosphate pathway
    B1NLA3E_01405
   00051 Fructose and mannose metabolism
    B1NLA3E_01405
   00052 Galactose metabolism
    B1NLA3E_01405
  09102 Energy metabolism
   00680 Methane metabolism
    B1NLA3E_01405
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    B1NLA3E_01405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:baci01009]
    B1NLA3E_01405
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:baci03019]
    B1NLA3E_01405
Enzymes [BR:baci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B1NLA3E_01405
Protein phosphatases and associated proteins [BR:baci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B1NLA3E_01405
Messenger RNA biogenesis [BR:baci03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     B1NLA3E_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AGK52065
UniProt: N0AVM0
LinkDB All DBs
Position
297648..298607
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAIRAVVRRGIYNGLEVYGVKHGYSGLMKGDFLNMDLGSVGDI
IHRGGTILRSTRCEEFKTVEGQKQAIISLQNASIDGLIVIGGDGSFQGANKLAKQGFPTI
GIPGTIDNDISGTEYTIGFDTTVNTVIEAIDKIRDTAYSHERICIIEVMGRHAGDIALWT
GISSGAESILIPEVANDIEDVMNRIIHGQERGKMHSIIVLAEGVCSGKDLKNEIKKRFDL
NTNVIVLGYLQRGGSPTVYDRMMASRMGAYAVDLLIRGKNGEMVGWKNGRLVNMLFEDAL
KDKHSINLSDYYLARSISI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgctgttctaacaagtgggggagattctccaggaatgaatgcagctatt
cgtgcagtagtacgaagaggaatttataatggactagaagtatatggagttaaacatggt
tattctggtttaatgaaaggcgattttttaaacatggaccttggaagtgttggggatatt
attcacaggggtggaacaatcttaagaagtactcgctgtgaagagttcaaaacagtagaa
ggacaaaaacaagcaataatatcactacaaaacgcaagtatagatggattaatagttatc
gggggagacggatctttccaaggagcaaataaattagccaaacaaggtttccctactatc
ggtattcctggaacaattgacaatgatatctctgggacagagtatacaataggctttgat
acaacagttaatactgttattgaagctatagataaaatacgtgatacagcgtattcacat
gaacgtatatgtattatagaagtaatggggaggcatgcaggggatattgccttatggaca
ggcataagctctggtgcagaatccattctaataccagaagtcgcaaatgatattgaagat
gtgatgaaccgaattatacatggacaagaacgaggcaaaatgcacagtattattgtttta
gcagaaggtgtgtgcagtggtaaagatctaaaaaatgagattaaaaagagatttgatctt
aacactaatgtcatcgttttgggatatttgcaacgtggtggatcaccaacagtttatgat
cgtatgatggcaagcaggatgggagcctatgcagttgatttattgatacgtggtaaaaat
ggggaaatggttggctggaaaaatggcagattagtaaatatgttatttgaggatgcatta
aaagacaagcattctattaatctttcagactactatttagctagaagtatttctatataa

DBGET integrated database retrieval system