KEGG   Bacillus sp. 1NLA3E: B1NLA3E_05010
Entry
B1NLA3E_05010     CDS       T02643                                 

Definition
(GenBank) hypothetical protein
Organism
baci  Bacillus sp. 1NLA3E
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_transf_7C Glyco_tranf_2_4 Mannosyl_trans3
Other DBs
NCBI-ProteinID: AGK52774
UniProt: N0ANA8
LinkDB
Position
1113487..1114371
AA seq 294 aa
MGIDEEKPLVSIVFPVKNEGENIKNTINSLYKTKTDYPYEIIVVDDNSEDGCCDYLIQSQ
DKKIKLVHANNAGAALARNIGGEQATGEYVIFCDAHLFFEDYWMDRLLEPLRAGIADAIN
PGIASADSPNKVGYGYTWNENLDPKWNIGKRGLFASPLIASGCLAMSKKVFDDIEGYERG
FRVWGRNDDDISLKLWLFGYKCFVLPEVKIRHIFRKKSPFKFTWNDVNYNFMRMAYSHFN
EERIEKCKKLIKHSNAVKIVEEVLKSDVLEQRERYLKKRKYDDDWYMKRFNVQF
NT seq 885 nt   +upstreamnt  +downstreamnt
atgggtatagatgaagaaaagccgcttgtttctattgtatttccagtgaaaaatgaagga
gaaaatattaaaaatacaatcaactccttatataaaactaaaacagactacccttacgaa
atcattgttgttgatgacaactcagaagatggttgttgtgattatttaatacaatcccag
gataaaaaaatcaaactggttcatgccaataatgcaggagctgctttagccagaaacatc
ggtggtgagcaagccacaggagagtatgttatattttgcgatgctcatttgttttttgaa
gattactggatggatagattattagaacctttaagggcaggaatcgctgatgccataaat
ccaggcattgccagcgccgatagtcctaacaaagttggatatggttatacatggaatgaa
aatttagaccccaagtggaatattggaaaaagaggactatttgcatcccctcttatagct
tcaggatgtttggcgatgagtaagaaagtgtttgatgacattgaaggatatgaaagagga
tttcgggtgtggggaaggaacgatgatgatatctctttaaaactatggttatttggttat
aaatgtttcgttttacctgaagtaaaaattcgccatatttttagaaagaaatcacccttt
aagtttacatggaatgatgtcaattataacttcatgcgaatggcttacagccattttaac
gaagaaagaattgaaaaatgtaaaaagctgataaaacattcgaacgcagttaaaatcgta
gaagaagtgttaaaaagcgatgttttggaacagcgggaacgttacttaaaaaaacgcaag
tatgatgatgattggtatatgaaacggtttaatgttcaattttaa

DBGET integrated database retrieval system