KEGG   Bacillus sp. 1NLA3E: B1NLA3E_08230Help
Entry
B1NLA3E_08230     CDS       T02643                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00620  Pyruvate metabolism
baci00680  Methane metabolism
baci01100  Metabolic pathways
baci01120  Microbial metabolism in diverse environments
baci01200  Carbon metabolism
Module
baci_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1NLA3E_08230
  Energy metabolism
   00680 Methane metabolism
    B1NLA3E_08230
Enzymes [BR:baci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B1NLA3E_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase HMMR_N
Motif
Other DBs
NCBI-ProteinID: AGK53408
UniProt: N0ARS6
LinkDB All DBs
Position
1800965..1803727
Genome map
AA seq 920 aa AA seqDB search
MTTELKLNDSNLALRRDVKYLGNILGEILVFHGGTDLLNKVEVIRMMCKNLRDHFETETY
AALKKEISELHTPMRKQVIRAFSVYFHLINAAEQNHRIRRRREYLLQEENSIQPGSIESA
ILTFKENDVSPDAIQKVLDSLSLELIITAHPTEATKRSILEIQKRIADLLINLDTPFLTK
KEQKKLQESLFNEVTVLWQTDELRHHKPTVLDEVRNGLYYFDQTLFDVLPDIHQEVEDSL
KENYQNYSWDIPNFLRFGSWIGGDRDGNPNVTPEVTWETLHKQRRLVLKKYKKVLVELMK
RFSHSAVRVNISEDLLRSVQTEEDKYLTDDKKWPIEAELYRRKFAIIIERLKQVGNSENG
YQTDTELLEDLFMIRDSIYQHYPSGHELKLLQKLIRQVQLFGFHLATLDIRNHSGEHEVA
IAEILKKVGITEAYQQLNEQEKVDTLQNILMDPRPLLLIDEDYSKETQEIINVFKMIKDA
HREFGKRSISVYLISMTQSVSDCLEVLVLAKEAGINRLHADGTSESNLNVAPLLETIDDL
IAGPKIMETLFQMPVYREHLHKMGDQQEIMLGYSDGSKDGGTLTANWKLYKAQLEIHETA
KKYKIGLKFFHGRGGSLGRGGGPLSRSIFSQPGETLGDGVKITEQGEVLSSRYLVEEIAY
RSLEQATSTLLLASAHISKESEQGHSRDERWVGAIEDISDFSLRKYQSLVFEDPDFLTYF
TQATPLNELKDLNIGSRPMSRKNGGKFEDLRAIPWVFAWTQSRQLFPAWYAAGTGLESFV
AKDSSNLQLLQQMYEGWPFFRSTIDNLQMALMKADIPTAKEYTSLVEDKTIVERIFNNIV
EEYNKTKAILLRITGDKELLDHTPNIQESVYRRNPYVDPLNFLQVELIKELRKADEIDEG
LLTEVLLTISGIAAGLRNTG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacagaattgaaattaaatgacagcaatcttgccttacgtcgagatgtaaaatat
cttggtaatatacttggcgaaatcttagtttttcatggtgggacagacctcttaaataaa
gttgaagtaattagaatgatgtgtaaaaatctccgtgatcacttcgaaacagaaacatac
gctgccctaaaaaaagaaatttcagagcttcacactccaatgcgcaaacaagtaattcgg
gctttttctgtttattttcacctcattaatgctgctgaacaaaatcaccgaattcggcgg
agaagggaatatctcctccaagaagaaaatagtattcaaccaggctcaattgaaagcgcc
attcttacttttaaagaaaacgatgtttccccagatgcgattcaaaaggtgctagattct
ttatcacttgagttaatcattacggctcatccaacggaagcaacgaaacgttcgattctt
gaaattcaaaagcggatcgctgatctattaatcaatcttgatacgccattccttaccaaa
aaggaacagaaaaagcttcaagaaagcttatttaatgaagtgacggtgttatggcaaaca
gatgaattgcggcaccacaagccaacagtattagatgaagtgagaaacggcttgtattac
tttgatcaaaccctttttgatgtcctaccagatattcatcaggaggttgaggatagtctg
aaggagaattatcaaaattatagctgggatattccaaattttcttcgctttggttcatgg
attggtggggaccgcgacggtaatccgaatgtaactccagaagtaacttgggaaacttta
cataaacaacgtaggcttgtcttgaaaaaatataaaaaagtactcgtagaacttatgaaa
cggtttagtcattctgcggtaagagtaaatattagtgaagacctcctacgttctgtgcaa
acagaagaagacaagtatttaactgatgataaaaagtggccaattgaagccgagttgtat
cgccgtaaatttgccatcatcattgaacgtcttaaacaagtagggaactcagagaacggc
tatcagactgatacggaattattagaagatttattcatgattcgcgacagcatatatcag
cattacccaagtggccatgaattaaagcttcttcaaaagttaatcagacaagttcaatta
ttcggcttccatttggctaccctcgatataagaaatcacagcggcgaacatgaagtggcg
atagcggaaatcctaaagaaggttgggattactgaagcctatcaacaacttaatgaacaa
gagaaagtggatacattacaaaacattttaatggacccaagaccactgttactcattgat
gaggattattcaaaagaaactcaagaaattatcaacgtcttcaaaatgattaaagatgct
catcgggaatttggaaaacgttctatctctgtttatttgatcagcatgactcaatctgta
agtgattgtcttgaggttttggttttagcaaaagaagcagggattaatcgcctccatgct
gacggaacatccgaaagtaatttaaatgtagccccactacttgaaacgattgatgattta
attgcaggaccaaaaatcatggaaacattgtttcaaatgccagtctaccgagagcacctc
cacaaaatgggggatcagcaggaaatcatgcttggatattctgatggaagtaaagacggc
ggtaccttaacggcgaactggaagctgtataaagcacaattagagatccatgaaacggcg
aaaaagtataaaatagggttgaaatttttccatggccgcggtggttcattaggtcgtggg
ggtggtccacttagcagaagtattttttctcagccaggtgaaacccttggggatggcgtg
aaaataaccgagcaaggggaagtattgtcttctcgttatctggttgaagaaattgcttac
cgcagtttagaacaggcaacatccaccttgttgctagcgtcggctcatatttcaaaagaa
tcggagcaagggcattcgcgcgatgaacgctgggttggagcgattgaagatatatcagac
ttttcgttacgaaaatatcagtcgcttgtgtttgaggacccggatttcttgacttatttt
acacaagccactcctttaaacgagctaaaggatctaaacattggttcgcgtccaatgagt
cgcaaaaatggtggtaaatttgaagatttgcgggcgattccttgggtatttgcttggact
caaagccgccagttatttcctgcttggtatgcagcaggtacagggttagaaagttttgtt
gctaaagatagctcaaatcttcagttgctgcagcaaatgtatgaaggatggccgtttttt
cgctcgacgattgataatttgcaaatggctctcatgaaggcagacattcccaccgctaaa
gaatatacttcacttgttgaagataaaacgattgtagaacgcattttcaataatattgta
gaagaatataacaagacaaaagccatactccttagaataacaggtgataaagagctactc
gatcatacaccgaacattcaagaatccgtgtaccgcagaaatccgtatgtggacccgtta
aactttttgcaggtggaattgatcaaagagcttaggaaagctgacgagatcgatgagggg
ctgttaacggaagttttgctaaccataagtgggattgcagcggggttacggaatactggt
tga

DBGET integrated database retrieval system