KEGG   Bacillus sp. 1NLA3E: B1NLA3E_10160Help
Entry
B1NLA3E_10160     CDS       T02643                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00010  Glycolysis / Gluconeogenesis
baci00071  Fatty acid degradation
baci00350  Tyrosine metabolism
baci00625  Chloroalkane and chloroalkene degradation
baci00626  Naphthalene degradation
baci01100  Metabolic pathways
baci01110  Biosynthesis of secondary metabolites
baci01120  Microbial metabolism in diverse environments
baci01130  Biosynthesis of antibiotics
baci01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B1NLA3E_10160
  Lipid metabolism
   00071 Fatty acid degradation
    B1NLA3E_10160
  Amino acid metabolism
   00350 Tyrosine metabolism
    B1NLA3E_10160
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B1NLA3E_10160
   00626 Naphthalene degradation
    B1NLA3E_10160
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B1NLA3E_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C CoA_binding Methyltransf_25 UDPG_MGDP_dh_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AGK53790
UniProt: N0B0J7
LinkDB All DBs
Position
complement(2227475..2228488)
Genome map
AA seq 337 aa AA seqDB search
MKAAVINEFHQQLEIKDVPVPELAYGEILVKIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVEAIAEGVSSIKVGDRVGVPWLYSACGECEYCLTGRETLCPDQINAGYSVDGGY
AEYCKAPANYVVKIPDGLDFHEVSPIFCAGVTTYKALKVSEAKPGDWVAIYGIGGLGHVA
LQYAKAMGFNVIAVDIQDDKLELAKQLGADISVNGLRVNPIEEIKAQVGGVQAAVSVAVT
KKAFEQAYGSVKRGGTLVVVGLPNADLPIPIFDTVLNGITVKGSIVGTRKDLQEAIEFAA
QGKVRTNIEVQPLNNINEVFDRMEKGYINGRVVLTLE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcagtaataaatgaatttcaccaacagttggaaattaaggatgtccccgta
cctgagttagcatatggggaaattcttgtaaaaatcaaagcatgcggagtctgccatact
gacctccacgctgcacatggggattggccagtgaaaccaaagcttcctctcatccctggt
catgagggagttgggatcgttgaagcaatagctgaaggtgtaagctctattaaagttgga
gaccgtgtcggtgttccatggctttattcagcctgtggtgagtgtgaatattgtctaact
ggccgtgaaacgttgtgcccagatcaaataaatgctggatattccgtcgatggaggctat
gcagaatattgtaaagcaccagctaactatgtagtgaaaattccagatggtcttgatttt
catgaagtttcaccaattttctgtgcgggtgtcactacctacaaggcattaaaggtatcg
gaggccaagcctggggattgggtggctatatatggaatcggcggcttaggacatgtggct
cttcaatatgcaaaagcaatgggtttcaacgttatcgctgttgatattcaagatgataag
ctagaattagccaaacaactaggggccgatatatcggtcaacgggttaagagtgaaccca
attgaggaaatcaaagcacaagtaggcggagttcaagcagcagttagtgttgctgttacg
aaaaaggcatttgaacaagcatacggctcagtaaaaagaggcggtacactagttgtagtt
ggccttccaaatgctgatttgccaattccaatttttgatacagttctaaatggtatcaca
gtgaaaggttctattgttggtactagaaaagatttacaggaagcgattgagtttgccgct
caaggaaaagttcgtacaaatatcgaagtccagccactaaataatattaatgaagtcttt
gatcgtatggaaaaaggatacattaacggacgggttgtattaactttggaataa

DBGET integrated database retrieval system