KEGG   Bacillus sp. 1NLA3E: B1NLA3E_11420Help
Entry
B1NLA3E_11420     CDS       T02643                                 

Definition
(GenBank) hypothetical protein
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00030  Pentose phosphate pathway
baci01100  Metabolic pathways
baci01120  Microbial metabolism in diverse environments
baci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B1NLA3E_11420
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     B1NLA3E_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AGK54036
UniProt: N0B044
LinkDB All DBs
Position
complement(2516875..2518677)
Genome map
AA seq 600 aa AA seqDB search
MNGWIGKIIRVNLANETIKTEPLNMQDAKLYLGGRGLGTKIYINEVDPKVDALSPENKMI
FLTGPLTGTVATCAGRFEVVSKSPLSDTIGACSSGGHFGPELKFAGYDGIIFEGKATKPL
YLYVNDDHIELRDASHLWGKEVPATTDELMKETDEEAKIACIGPAGEKLVLFATIMNDKN
RAAGRSGLGAVMGSKNLKAIVVRGTKSITVAKKKEFIDACMDSLSKIKANPVTGGGLPAY
GTQVLVNILNESGGLPTRNWQESVFDKAEDISGETLAEKYLVRNRGCFDCSIGCGRVTKI
ERSQYTNFGEGPEYEAGWSFGADCGINNLEAVCESNFLCNELGMDPITMGSTIACAMELY
EKGYATFKDTGMDLQFGNDKSIVELTRMTGYREGFGDKLALGSYRMAAEFGHSELSMSVK
KLEMPAYDGRALQGMGLEYATSNRGGCHVRGYMTSPEILGLPVKMDPLVTEGKAAMLKIF
QDLTAVVDSVGMCLFTTFAIGLPEIAEMVRTCTGINYTDEEVLQIGERIWNLEKIINMEC
GITVKDDTLPPRLLNEPISEGPAKGKVVELDTMLPEYYSLRGWDKEGVPSETKKEELSLK
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaacggttggataggaaaaatcatccgtgttaatttagccaatgaaacaattaaaacc
gaaccccttaatatgcaggatgcaaagctttatctgggcggaaggggccttggaacaaag
atctacataaacgaagttgacccaaaggtggatgctctcagtcctgaaaacaagatgata
ttcttaaccggtccgttaacaggcacggtggctacttgcgcgggaaggtttgaggtagta
tcaaaatcgcctttgtcagatacaatcggagcatgcagttctggcggacattttggacca
gaactgaaatttgcaggttacgatggaatcatttttgaaggtaaagctacaaagccatta
tacctttatgttaatgatgatcatattgaacttagagatgccagccatctttggggcaag
gaagtgcctgcaacgacagatgaactgatgaaagaaacggatgaggaagcaaaaattgcc
tgtatagggccggccggtgaaaagcttgtattgttcgctaccattatgaatgataaaaac
cgagctgctggacgttcaggacttggggccgttatgggttccaaaaacctaaaggcaatc
gttgtaagaggtaccaagtcaataacggttgcgaagaaaaaagaatttatagatgcttgc
atggattcattgagcaagataaaagcaaatcctgtaaccggtggcggacttccagcatat
ggaacacaggtactcgtaaatattctaaacgagtctggcggacttccaacaaggaactgg
caggaatctgtttttgataaagcagaggatatcagtggcgaaaccctcgcagagaagtat
ctcgtaagaaacagaggctgctttgactgttcgataggttgcggtagggtcacgaaaata
gagagatcacaatacacaaactttggtgaagggcctgaatatgaagcaggctggtcgttt
ggagcggactgcggtataaataacctcgaagcggtatgtgaatcaaacttcctatgcaat
gagcttggcatggatccgattacaatgggttcaaccattgcttgtgccatggaattgtat
gagaagggttacgctacattcaaagatactggaatggatttacaatttggcaatgacaaa
tcaattgtggaacttacaagaatgactggttacagagaaggcttcggagacaagctggcg
ttaggctcctatagaatggcggccgaattcggtcattctgaactttcgatgtctgtcaaa
aagttggaaatgcctgcttacgacggacgtgccctgcagggaatgggtcttgaatatgct
acctctaatcgtggaggctgccatgtccgcggttatatgacatcacccgaaatacttggt
ttgcctgtaaaaatggatccgctagtgaccgaaggaaaggctgccatgctaaaaatattc
caggatctcacggcagttgtggattctgtaggaatgtgcctatttaccacatttgcaatt
ggcctgcctgagattgctgaaatggtaaggacctgtacaggcataaactatacggatgaa
gaagttcttcaaatcggtgaaagaatatggaaccttgagaagattatcaatatggagtgt
ggaattacagtgaaggatgataccctgcctccaagacttttgaatgaaccaatttccgag
ggtcctgcaaaaggcaaggttgtcgagctggatacaatgcttcccgaatactattcatta
aggggatgggataaggaaggcgtaccatccgaaacgaaaaaggaagagctttcgctaaaa
taa

DBGET integrated database retrieval system