KEGG   Bacillus sp. 1NLA3E: B1NLA3E_15940Help
Entry
B1NLA3E_15940     CDS       T02643                                 

Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Brite
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B1NLA3E_15940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGK54932
UniProt: N0AY45
LinkDB All DBs
Position
complement(3460711..3461319)
Genome map
AA seq 202 aa AA seqDB search
MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNNALQGNPDLLGKSVDEVIAN
LDAVPEAVRTAVRNNGGGHANHSLFWQLLSPNGGGEPTGELAEAINKKFGSFESFKEEFA
KAATTRFGSGWAWLSVNNGELEVTSSPNQDSPVMEGKTPILGLDVWEHAYYLKYQNRRPE
YITSFWNVVNWAEVTKRFNQAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaccgcaattaccttatgcctatgatgcactagaaccacacattgac
aaagaaacaatgaacattcatcacacaaaacaccataacacatatgttaccaacttaaat
aacgcattacagggtaaccctgatctacttgggaaatctgttgatgaagtcatcgctaat
ttagatgccgttcccgaagctgttcgtactgctgtaagaaataatggtggtggtcatgca
aatcattcattattttggcagctactgtctccaaatggtggcggtgagccaacaggtgaa
ttagcagaagcaattaacaaaaagtttggtagctttgaaagctttaaagaagaatttgca
aaggctgcaacaactcgttttggttcaggttgggcctggctttccgttaataatggagaa
ttagaagtgactagttctcctaatcaagattctcctgtaatggaaggtaaaactccaatc
cttggtttagatgtatgggagcatgcatattatttaaaataccaaaaccgtcgcccagaa
tatattacttctttctggaatgtagtaaattgggctgaagtaacaaaacgttttaaccaa
gcaaaataa

DBGET integrated database retrieval system