KEGG   Bacillus sp. 1NLA3E: B1NLA3E_17125
Entry
B1NLA3E_17125     CDS       T02643                                 

Definition
(GenBank) formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:baci00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    B1NLA3E_17125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:baci03400]
    B1NLA3E_17125
Enzymes [BR:baci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     B1NLA3E_17125
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     B1NLA3E_17125
DNA repair and recombination proteins [BR:baci03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     B1NLA3E_17125
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS FbpA zinc-ribbons_6 DZR Zn-ribbon_8 RNHCP Auto_anti-p27
Other DBs
NCBI-ProteinID: AGK55169
UniProt: N0AVI8
LinkDB
Position
complement(3702979..3703806)
AA seq 275 aa
MPELPEVETVKRTLEALVLQKEINSVSVFWPKIVKRPDEVVQFQDALKGQKIQKMGRRGK
FLIFYTEDYALVSHLRMEGKYGVFSTEAPVEKHTHVIFHFTDGTELRYKDIRKFGTMHLF
SKGTEFEQPPLSLLGPEPFSEKFTVQYLTEILARTNRKIKVTLLDQATVVGLGNIYVDET
LFRSKIHPERQAASLSSEEITALHQEIVATLTEAVTKGGSTIRSYLNSQGQIGMFQLQLF
VYGKKDEPCQRCGTELQKIKVGGRGTHFCPSCQRL
NT seq 828 nt   +upstreamnt  +downstreamnt
ttgcctgaacttccagaggttgaaacagtaaaaagaacattagaggcactggtcctgcaa
aaagaaattaatagtgtatctgttttttggccgaaaatagtgaaacgaccagatgaagtt
gttcaatttcaggacgctttaaaagggcagaaaatccaaaaaatggggagaagagggaag
tttttaattttttacacagaagattatgctcttgtttctcatttaaggatggaaggaaaa
tatggggttttttcaacagaagctcccgttgaaaagcatacacatgttattttccatttt
acagatggaacagagcttcgttataaagacattcgtaaatttggaacaatgcacttattt
tccaaagggactgagtttgaacagccacccttatctttattaggccctgagccattttcg
gaaaaatttacagtgcaatatttaactgaaatattagcgcgaacaaataggaaaataaag
gtaactttattagaccaggccactgttgttgggcttggaaatatttatgtggatgagacg
ttatttcgttcaaaaatacatccagagagacaagcagcttcattatcgagcgaagaaatt
acggctctccaccaagaaattgtggcgacgttgacggaagctgtaactaaaggtggtagt
acaattcggtcttatctgaattcccaagggcaaatcggaatgtttcaattacaattgttt
gtttacggtaaaaaagacgaaccgtgtcaaagatgtggaactgaacttcaaaaaatcaaa
gttggtggacgtggtactcatttttgtcctagctgtcaacgactataa

DBGET integrated database retrieval system