KEGG   Bacillus sp. 1NLA3E: B1NLA3E_21025Help
Entry
B1NLA3E_21025     CDS       T02643                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00030  Pentose phosphate pathway
baci01100  Metabolic pathways
baci01110  Biosynthesis of secondary metabolites
baci01120  Microbial metabolism in diverse environments
baci01130  Biosynthesis of antibiotics
baci01200  Carbon metabolism
baci01230  Biosynthesis of amino acids
Module
baci_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
baci_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B1NLA3E_21025
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    B1NLA3E_21025
Enzymes [BR:baci01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     B1NLA3E_21025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AGK55943
UniProt: N0AZ78
LinkDB All DBs
Position
complement(4547969..4548787)
Genome map
AA seq 272 aa AA seqDB search
MQKANLEETAKKIRADILKMIYTAQSGHPGGSLSLVEILIALYYDVANIDPANPNKEDRD
RIVLSKGHGCPALYAILANKGYFPIEDLKDFRQVHSHLQGHPDMKKTPGVDANTGSLGQG
VSISTGMALAAKHRKMDYKVYAIIGDGEVQEGLVWEAAMASAHYKLDNLVVILDHNGLQI
DGSNDDVLSIGDIMEKYRVFGFECFKVDGHDLDAIHYALKAPVSGKPKFICCETHKGNGI
SFMEDEYGWHGKAPNQQEFEKAMEELGVTING
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagctaatctagaagaaactgcaaaaaaaatacgggcagatattttaaaaatg
atctatactgctcaatctggccatcctggtgggtcactttctcttgtcgagattttaata
gctttatattatgatgtagcaaatattgatccagcaaatccaaataaagaggatagggac
cggattgtccttagtaaaggtcatggttgtccagctctctatgcaatattagcaaataag
ggctattttcctatagaagatctcaaggatttccgccaagtccatagccatttacaaggg
caccccgatatgaagaaaacgccaggtgttgatgctaatactggttcgcttggacaagga
gtatccatttcaactggaatggctttagccgcaaaacatagaaaaatggattataaagtg
tatgcaattatcggagatggtgaagtccaagaaggtttggtttgggaagcggcaatggcc
tctgcacattacaaattagataatttggttgttattttagatcataacggtcttcaaatt
gatggctccaatgatgatgttttaagcattggagatattatggaaaaatatagagtgttt
ggttttgaatgtttcaaggtggatggacatgaccttgatgcgattcactatgcacttaaa
gcaccagtttccgggaagcccaaatttatttgttgtgaaacacataaggggaatgggatt
tcctttatggaagatgaatatggatggcatggaaaagcaccgaatcaacaagaatttgaa
aaagctatggaagaattgggggtaacgataaatgggtaa

DBGET integrated database retrieval system