KEGG   Bacillus sp. BS34A: BS34A_00900Help
Entry
BS34A_00900       CDS       T03833                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bacl  Bacillus sp. BS34A
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bacl03110]
    BS34A_00900 (hslO)
Chaperones and folding catalysts [BR:bacl03110]
 Heat shock proteins
  HSP33
   BS34A_00900 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: CEJ75618
LinkDB All DBs
Position
I:79879..80754
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDD
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTNGTLSVVK
DLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLM
PGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKE
RFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtaaaagcacttgcgtatgacggaaaagttcgggcttatgcagcgaga
acgactgatatggtaaatgaggggcagagacgccatggtacgtggccgacagcatccgct
gcactaggccgtacaatgacagcttcacttatgctcggcgctatgctgaagggcgatgat
aagctgaccgtgaaaatcgagggcggaggtccgatcggagctattgtagctgatgccaat
gccaaaggagaagtcagagcctatgtctctaacccgcaagttcattttgatttaaatgaa
caaggtaagcttgatgtcagacgtgcggttggaacaaacggaacgttaagtgtcgtaaaa
gatttaggtttgcgcgagttcttcacaggacaagtagaaatcgtttcaggagaattagga
gatgattttacttactatcttgtgtcatctgagcaggttccttcatcagtgggcgtaggt
gtgctcgtaaatcctgacaataccattcttgcggcagggggctttattattcagctgatg
ccgggaacagatgatgaaacaatcacaaaaattgaacagcgtctatctcaagtagagccg
atttctaagctcatccaaaaagggctgacaccagaagaaattttagaagaagtcctaggc
gagaaacctgagattttggaaacgatgcctgtcagattccattgcccttgttcaaaagaa
cggttcgaaacagccattttaggactaggcaaaaaagaaattcaagatatgatagaagaa
gatggacaagccgaagcagtatgccatttttgtaatgaaaagtacttatttacaaaagaa
gagctggaagggcttcgtgaccaaactacccgctaa

DBGET integrated database retrieval system