KEGG   Bacillus sp. BS34A: BS34A_03960Help
Entry
BS34A_03960       CDS       T03833                                 

Definition
(GenBank) RDD family protein
Organism
bacl  Bacillus sp. BS34A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RDD ABC_export DUF2070
Motif
Other DBs
NCBI-ProteinID: CEJ75884
LinkDB All DBs
Position
I:369222..369677
Genome map
AA seq 151 aa AA seqDB search
MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFISLVVLLYSILLPMFW
RGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGLGLIASLILIAVREDKR
TLHDLIAGTYVTYATPGEEELNADEEIRKSE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttacaaaccagccggattttggatcagacttggagctgcattgttagactac
attatagtctccgtgccgcttttgctgatctattggctgattacaggaaaagacccaaac
gacagcatgttcatcagtttggttgttctgctgtattctattttgctgccgatgttttgg
cgcggttatcttatcggaaaaaggatctgcggaatcagaatcgtaaaaaaagacggatca
caggtcagtctgttaacaatgtttttacgggttattgtagccggcctggtttactgtata
accttcggactcggcttgatcgccagcctgattctgattgccgtacgagaagacaaacgg
accctgcatgatttaatcgcgggaacatatgtcacttatgcgacaccaggtgaagaggaa
cttaatgctgacgaagagattagaaagagcgaataa

DBGET integrated database retrieval system