KEGG   Bacillus sp. BS34A: BS34A_04250Help
Entry
BS34A_04250       CDS       T03833                                 

Definition
(GenBank) Pectate lyase superfamily protein
Organism
bacl  Bacillus sp. BS34A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_helix NosD Pectate_lyase_3
Motif
Other DBs
NCBI-ProteinID: CEJ75913
LinkDB All DBs
Position
I:417978..419732
Genome map
AA seq 584 aa AA seqDB search
MAEFILNAADFGVPRDGKTDSTERINQCLSTAVSKGYHTVWFPKGTYLIDATLGGDLNQR
FRNAGIIVPGNLEIMMDPECIMKVIPNSSWGYSAFYVGKQENITISGGQIIGERDEHTYA
SAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRGLKTNQDYRTSEQIIIRR
CEVRRSRRNNISITGCDMVTVEECLIEDAGTGNGTAPKFGIDIEGYGEGDVDYEEPINVS
IRNNHFVGNVSSSVTNFNGYGILIEGNHSDNTISYGYGTQTVIKGNILRRPEDAAAAPRV
GITGLGVSQGKETSDAVIAGNLITGFSTGIDVRGKSVLVTNNKISNFENTGILVYQSSDV
KVDGNQIQNGLSETRRSIGLRAVLSDDIAFLNNCLIQVVDGVNVSGGNMIIKDNLLRKFS
RGIWIAQGNAVIEGNTLNPDAFEAVPESYSVSVTNNAGAIIKNNTFKEFKNYPIYCSTSA
KTSIIGNHLERSPLLVTIYISAGVHEIFDNTISVNRTAGNPIVIYLNGSAGSIISGNTIN
NLSAGTATAIQTNTSTNSKIIGNRIFKGTINKHSSDTIDGNMIV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaattcatattaaatgcagcggatttcggtgttcctagagatggtaaaacggat
tcgacagaacggattaatcagtgcctcagtacagctgtttcgaaaggctatcatactgtc
tggtttccaaagggaacatatttaatagacgcaacgcttggcggagatcttaatcagagg
tttcgaaacgcggggatcattgttcccggcaaccttgagattatgatggaccccgaatgt
atcatgaaagtgataccgaatagttcgtggggttattccgcattttatgtaggcaagcaa
gagaatataactatttccggaggacaaattatcggcgaacgggatgagcatacgtatgcc
tcggcggggataaggtcaacccatgaatggggctttggcatatgtattgaaggatgctcg
aatgttgtcattgatgatgtgaaaatttccgattttaccggcgatgggatcatagtcagc
ccaaggggattaaagaccaatcaagattatcgaacgtcagagcaaattatcatccgccgc
tgtgaggttcggcggtcgaggagaaataacatttccattaccggatgtgacatggtcacg
gtggaggaatgcttgattgaagatgccggaacggggaatggaacagcgccgaaattcgga
attgacattgaaggatatggcgaaggtgacgttgattatgaggaaccgattaatgtatca
attcgcaataaccactttgttggaaacgtttcaagttctgtgaccaattttaacgggtat
ggcattttaatagaaggaaatcactcagacaatacaatcagctacggatatgggacgcaa
acagtgatcaagggcaatattctgagacgccctgaagacgcggcggctgcgccaagagtc
gggataaccggactcggtgtatcacaaggaaaagagaccagtgatgcagtgatcgctggc
aacctcattaccggattttcaactggaattgatgtcaggggaaagagcgttcttgtgacg
aacaacaaaatcagcaactttgaaaacacagggatattggtttatcagtcctccgacgta
aaggtagacggaaaccaaattcaaaacggactgtctgaaacaaggcgcagcatcggtctt
cgcgcagtgctgtcagatgacatcgcatttctgaataactgtctcattcaagtcgttgac
ggtgtgaacgtttccggcggaaatatgatcattaaagataatctcctgagaaaattcagc
cggggcatttggattgctcaagggaacgcggtgattgaagggaatacactgaatcctgac
gcgtttgaagcagtgccggaatcatattctgtttccgtcacaaacaatgccggcgccatc
atcaaaaacaatacatttaaagagttcaaaaattaccccatttattgctccacaagtgca
aaaacctcaattatcggcaaccacttagagcgatccccgcttttggtcaccatctatatc
agcgcaggtgtgcatgagatttttgataataccatttcagtcaacagaacagccgggaat
ccgattgtgatttatctcaatggctctgcaggctctatcatctctggaaacaccatcaat
aacctctccgcgggcactgcgacagctattcaaacaaacacgtcaaccaattccaaaatc
atcggcaaccgcatttttaaagggaccatcaacaaacacagcagtgatacaatagacggc
aatatgattgtctga

DBGET integrated database retrieval system