KEGG   Bacillus sp. BS34A: BS34A_08350Help
Entry
BS34A_08350       CDS       T03833                                 

Gene name
yfmT
Definition
(GenBank) aldehyde dehydrogenase YfmT
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00627  Aminobenzoate degradation
bacl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BS34A_08350 (yfmT)
Enzymes [BR:bacl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BS34A_08350 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CEJ76301
LinkDB All DBs
Position
I:807069..808526
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKK
WDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFP
IRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFENAGIPAGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIY
DKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGGFNG
TIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagagttgaataaacagtttatcggcgggaaatggcaggagggcagc
agcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcacaacattccgt
aaagcgactgctgacgatgtagatgaagcgtatcgggcagcggcgctggcaaagaaaaaa
tgggatgcggtcaacccgttcgagaaaagaaccattttagaaaaagccgtcacgtatatt
gaagaaaatgaagaagccattatttatttgattatggaggagctaggcggtacaaggctc
aaagcagcttttgaaatcggtcttgtcaaaaacatcataaaagaagcggcaacgttccca
atccgcatggaggggaaaattcttccgtcaacaatagatggcaaggaaaacagattatat
cgcgtgccggcaggcgttgtcggtgtcatcagtccgtttaacttcccattctttttatct
atgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgctaaagccgcatgag
gaaacgccgatttgcggcggaacgctgattgcgaaaatttttgagaacgcgggaattcca
gcggggctgctgaatgttgttgtcacagacattgctgaaatcggcgacagcttcgttgag
catccagtgccgcggatcatctcatttaccggttctacgaaagtcggcagctacatcgga
cagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcgggaacagcgccttc
atcgtacttgaggatgcagatatagaatatgcggtcaatgcggcggtgttcagccgattt
acacatcaagggcagatttgcatgtcagccaaccgcgtgcttgttcattcttctatttat
gacaagttccttgagctgtaccaggcaaaagtggaatcgctgaaagtcggcgacccaatg
gaccctgatacgattatcgggccattaatcaacagcagacagacggacgggctgatgaag
actgtagagcaagcaattgaagaaggcgctgtaccagtgaagcttggcggatttaacggg
acgatcgtggaaccgacgatcttaaaagacgtcaaaccgttcatgagcattgccaaggaa
gagctgttcggaccagtcgtctcctttatgaagtttgattcagaagacgaagcggtggat
atcgcaaacgaaaccccgtttggcttgagcggtgccgtacatacgtcaaatcttgagcgc
ggcgtggcttttgcgaaacgcattgaaacaggcatgattcacgtcaatgacacgaccatc
aatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggccgtttaaac
ggtgagtggagcctcgaagaatttacaacgctgaaatggatctcggtccagcacgaaaaa
cgcagcttcccttattaa

DBGET integrated database retrieval system