KEGG   Bacillus sp. BS34A: BS34A_15080Help
Entry
BS34A_15080       CDS       T03833                                 

Gene name
ykrV
Definition
(GenBank) transaminase MtnE
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00270  Cysteine and methionine metabolism
bacl01100  Metabolic pathways
Module
bacl_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BS34A_15080 (ykrV)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacl01007]
    BS34A_15080 (ykrV)
Enzymes [BR:bacl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BS34A_15080 (ykrV)
Amino acid related enzymes [BR:bacl01007]
 Aminotransferase (transaminase)
  Class I
   BS34A_15080 (ykrV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CEJ76937
LinkDB All DBs
Position
I:1425618..1426814
Genome map
AA seq 398 aa AA seqDB search
MKFEQSHVLKELPKQFFASLVQKVNRKLAEGHDVINLGQGNPDQPTPEHIVEEMKRAVAD
PENHKYSSFRGSYRLKSAAAAFYKREYGIDLDPETEVAVLFGGKAGLVELPQCLLNPGDT
ILVPDPGYPDYWSGVTLAKAKMEMMPLVKDRAFLPDYSSITAEIREQAKLMYLNYPNNPT
GAVATSEFFEDTVRFAAENGICVVHDFAYGAVGFDGCKPLSFLQTEGAKDIGIEIYTLSK
TYNMAGWRVGFAVGNASVIEAINLYQDHMFVSLFRATQEAAAEALLADQTCVAEQNARYE
SRRNAWITACREIGWDVTAPAGSFFAWLPVPEGYTSEQFSDLLLEKANVAVAAGNGFGEY
GEGYVRVGLLTSEERLKEAAYRIGKLNLFTQKSIDKTL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaacagtctcatgtattgaaggaattgcctaaacaattcttcgcttctctg
gtgcagaaagtgaaccgaaagcttgcagaaggacatgacgttatcaatctgggacaggga
aatccagatcagccgactcctgagcatattgttgaggagatgaaacgagctgtcgctgat
cctgagaatcataaatattcgtcttttcgcggctcataccgtctgaagtcagcggctgct
gcattttacaaaagagaatacggcattgatctggatccggaaaccgaagtcgctgtatta
ttcggcggaaaagccggtctagtcgagctcccgcaatgcttgttgaatcccggtgatacg
attttagttcccgatccgggttatcctgattactggtcgggtgtcacacttgcaaaagca
aagatggaaatgatgccgctcgtaaaggacagagcgtttctccctgattacagcagcata
accgctgaaataagggaacaggcgaaattgatgtatttgaattatccgaataatccgact
ggagctgttgctacttccgagttctttgaagataccgtgcgttttgcggctgaaaacgga
atctgcgtcgttcacgattttgcttacggcgctgtaggatttgacggctgcaagccttta
agctttttgcagactgaaggtgcgaaggatatcggaattgaaatttacacgctgtcaaaa
acgtataatatggcaggatggcgggttggctttgccgtcggaaacgcttcggtcattgaa
gcgatcaatctttatcaagaccatatgtttgtcagtcttttcagagcgactcaggaggct
gcagcagaggcactgttagccgatcagacgtgtgtggcagagcaaaatgccaggtatgag
agcaggagaaacgcttggatcacggcatgccgggaaatcggctgggatgtaacagctccc
gcaggttctttttttgcatggctgcctgtgcctgaaggctatacttctgagcagttctca
gatcttttgctggaaaaagcgaatgtggcagttgcggctggaaacggcttcggtgaatat
ggcgagggctacgtcagagtcggacttttaacaagtgaagaaagacttaaggaagccgct
tatcgaattggcaaactgaacctgtttacccaaaaaagcattgacaagaccttataa

DBGET integrated database retrieval system