KEGG   Bacillus sp. BS34A: BS34A_17620Help
Entry
BS34A_17620       CDS       T03833                                 

Gene name
smc_2
Definition
(GenBank) chromosome partition protein Smc
  KO
K03529  chromosome segregation protein
Organism
bacl  Bacillus sp. BS34A
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacl03036]
    BS34A_17620 (smc_2)
Chromosome and associated proteins [BR:bacl03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    BS34A_17620 (smc_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_15 AAA_29 ERM DUF2647 UPF0242 ABC_tran
Motif
Other DBs
NCBI-ProteinID: CEJ77182
LinkDB All DBs
Position
I:1666537..1670097
Genome map
AA seq 1186 aa AA seqDB search
MFLKRLDVIGFKSFAERISVDFVKGVTAVVGPNGSGKSNITDAIRWVLGEQSARSLRGGK
MEDIIFAGSDSRKRLNLAEVTLTLDNDDHFLPIDFHEVSVTRRVYRSGESEFLINNQPCR
LKDIIDLFMDSGLGKEAFSIISQGKVEEILSSKAEDRRSIFEEAAGVLKYKTRKKKAENK
LFETQDNLNRVEDILHELEGQVEPLKIQASIAKDYLEKKKELEHVEIALTAYDIEELHGK
WSTLKEKVQMAKEEELAESSAISAKEAKIEDTRDKIQALDESVDELQQVLLVTSEELEKL
EGRKEVLKERKKNAVQNQEQLEEAIVQFQQKETVLKEELSKQEAVFETLQAEVKQLRAQV
KEKQQALSLHNENVEEKIEQLKSDYFELLNSQASIRNELQLLDDQMSQSAVTLQRLADNN
EKHLQERHDISARKAACETEFARIEQEIHSQVGAYRDMQTKYEQKKRQYEKNESALYQAY
QYVQQARSKKDMLETMQGDFSGFYQGVKEVLKAKERLGGIRGAVLELISTEQKYETAIEI
ALGASAQHVVTDDEQSARKAIQYLKQNSFGRATFLPLSVIRDRQLQSRDAETAARHSSFL
GVASELVTFDPAYRSVIQNLLGTVLITEDLKGANELAKLLGHRYRIVTLEGDVVNPGGSM
TGGAVKKKNNSLLGRSRELEDVTKRLAEMEEKTALLEQEVKTLKHSIQDMEKKLADLRET
GEGLRLKQQDVKGQLYELQVAEKNINTHLELYDQEKSALSESDEERKVRKRKLEEELSAV
SEKMKQLEEDIDRLTKQKQTQSSTKESLSNELTELKIAAAKKEQACKGEEDNLARLKKEL
TETELALKEAKEDLSFLTSEMSSSTSGEEKLEEAAKHKLNDKTKTIELIALRRDQRIKLQ
HGLDTYERELKEMKRLYKQKTTLLKDEEVKLGRMEVELDNLLQYLREEYSLSFEGAKEKY
QLETDPEEARKRVKLIKLAIEELGTVNLGSIDEFERVNERYKFLSEQKEDLTEAKNTLFQ
VIEEMDEEMTKRFNDTFVQIRSHFDQVFRSLFGGGRAELRLTDPNDLLHSGVEIIAQPPG
KKLQNLNLLSGGERALTAIALLFSILKVRPVPFCVLDEVEAALDEANVFRFAQYLKKYSS
DTQFIVITHRKGTMEEADVLYGVTMQESGVSKVISVKLEETKEFVQ
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcaaacgtttagacgttataggatttaaatcatttgcagaacggatttccgta
gacttcgttaaaggcgtgacagcagttgtcgggccgaacggaagcggaaaaagcaacatc
acggatgccattcgctgggttctcggcgaacaatcggcacgctctcttcgcggcggaaaa
atggaagacatcatttttgctgggagtgattcaagaaagcgattaaatctagctgaagtt
acgcttactcttgataatgatgatcatttcttgccaattgacttccacgaggtgagtgtc
acaagacgtgtgtacagatcaggtgagagtgagtttctgattaacaatcagccatgccgc
ttgaaagatattattgatttatttatggactctgggcttggtaaagaagcattttctatt
atcagccaagggaaagtggaagagatcctgagcagcaaagcggaggatcgccgcagtatc
tttgaagaagcggccggggtgcttaaatataaaacgagaaagaaaaaagcagaaaataaa
ctgtttgagacacaggacaatctaaatcgggtagaagatatattacatgagcttgaagga
caggttgaacctcttaaaattcaagcttcaatagcgaaagactaccttgagaaaaagaaa
gagctggagcatgttgaaattgcgctgactgcctatgatatcgaagagctgcatggtaaa
tggtcgactcttaaagagaaagtgcagatggcaaaagaagaagagcttgctgaatcgtct
gctatttctgcgaaagaagcaaagattgaggatacaagggacaaaatacaagcgcttgat
gagtcagtagatgagctccagcaagttttactggtaactagtgaagagctggaaaagctt
gaaggccgtaaagaagtcctgaaagaacgaaagaaaaacgctgtgcaaaaccaagaacag
cttgaagaagccatcgttcagttccagcaaaaagaaacggttctgaaagaagagctttcg
aagcaggaagctgtcttcgaaacgcttcaggctgaggtgaagcagttaagggcgcaagta
aaagaaaaacagcaggctctcagtcttcacaatgaaaatgtcgaagagaaaatcgagcag
ctgaaaagtgattattttgagctgttaaacagccaggcttcgatacgcaacgaactccag
cttcttgatgaccagatgtcccaatccgctgtcacattgcagagacttgcggacaacaat
gaaaagcacctgcaggaacggcatgatatttctgcgcgtaaagccgcatgtgaaacggaa
tttgcccgaattgagcaggagattcacagtcaagtcggtgcatatcgtgatatgcagaca
aaatatgagcagaaaaagcgccaatacgaaaaaaatgaatccgctctgtatcaggcatac
caatacgttcagcaagcgagatcaaaaaaggacatgcttgagacgatgcagggagatttc
tccggcttttatcaaggtgttaaagaagtgctgaaagcgaaagagcgccttggcggaatt
cgcggagcggttcttgagctgatttctacagaacagaagtatgaaacggccattgaaata
gcgctcggcgcttctgctcaacacgtcgtgaccgacgatgaacaatctgcccgcaaagcg
attcaatatttaaagcagaattccttcggccgggcgacgtttctgcctctttctgttatt
agagaccgccagcttcaaagccgtgacgcggaaacagccgcccggcattcatcatttctc
ggggttgccagtgaacttgtcacatttgatcctgcgtatcgaagcgtcatccagaatctt
cttggaaccgttctgatcacagaggacttaaagggtgcaaacgagcttgcgaagcttctc
gggcaccggtaccgcatcgtaacccttgagggagatgttgtgaaccccggtggttcaatg
acgggcggcgcggttaaaaagaaaaataactccctccttggaagaagccgggagctagaa
gatgtgacgaaacggctcgctgaaatggaagagaaaacggcactgcttgaacaagaggtc
aaaacccttaagcactccattcaggatatggagaaaaaactggctgacttaagagaaacc
ggggaaggcttaaggttaaagcagcaggatgtgaaaggccagctgtacgaacttcaagtt
gccgagaaaaatatcaatacccatttagagctctatgatcaagaaaaatctgctctgtca
gaaagcgatgaagagagaaaagtgcgcaaacgcaagcttgaagaagagctctctgccgta
tctgaaaagatgaaacagcttgaagaggacatagacagactgacaaaacaaaaacaaacg
caatcctcaacgaaagagtctctctccaacgagctgactgagctgaagatcgcagcggcc
aaaaaagagcaggcttgcaagggggaagaggacaaccttgccagattaaagaaagagctc
actgaaacagagcttgcgttaaaagaagcaaaagaagacttaagcttcttaacgtcagag
atgtcatctagcaccagcggcgaagaaaagctggaagaagcagcaaaacataaattgaat
gacaaaacgaaaacgatcgaactgattgcattaaggcgcgatcagcgcatcaagcttcag
catgggcttgatacgtatgagcgtgagctgaaagaaatgaaacgcctgtataaacaaaaa
acaacgctcttaaaagacgaagaagtcaaacttggacgaatggaagtcgagcttgataat
ttactccaatacttacgggaggaatacagcttgtcctttgagggggcaaaagagaaatat
cagcttgaaactgatccagaggaagccagaaagcgcgtgaagctgattaaactcgcaatt
gaagagctgggtaccgtgaacctcggaagcatagatgagtttgagagggtcaacgaacgg
tacaagtttctgtcggaacaaaaagaagatttaacagaagcgaaaaataccttgttccaa
gtgattgaagaaatggatgaagaaatgacgaagcgctttaacgacacattcgtccaaatc
cgctcacactttgatcaagttttccgctccttattcggaggagggcgagctgaactgagg
ctcaccgatcctaacgatctgcttcattcaggagtcgagattatcgctcagccgccgggg
aaaaagctgcaaaacttaaacctcctgtcaggcggagagcgtgcgcttactgctatagcg
ctcttattctcaatcctaaaggttcgtccagtgccgttttgcgtccttgacgaagtagag
gctgcgctcgacgaagcgaatgtgttccgatttgcgcagtatttaaaaaaatacagcagc
gatactcagtttattgtgattacccacagaaaaggaacgatggaggaagcggatgtgctt
tatggcgtaaccatgcaggaatccggtgtttccaaggtaatttcagttaagctggaagaa
acaaaagaattcgttcagtaa

DBGET integrated database retrieval system